BLASTX nr result
ID: Glycyrrhiza34_contig00023218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023218 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN44278.1 Pentatricopeptide repeat-containing protein, mitochon... 79 2e-15 KRH64583.1 hypothetical protein GLYMA_04G243200 [Glycine max] 79 2e-15 XP_003522561.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-15 KRH53339.1 hypothetical protein GLYMA_06G120100 [Glycine max] 78 4e-15 XP_006581604.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 4e-15 KHN46962.1 Pentatricopeptide repeat-containing protein, mitochon... 78 4e-15 XP_004503044.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 2e-14 GAU39230.1 hypothetical protein TSUD_396770 [Trifolium subterran... 76 3e-14 XP_013461348.1 PPR containing plant-like protein [Medicago trunc... 76 3e-14 XP_017420402.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 3e-14 XP_014522307.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 1e-13 XP_015888477.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 7e-12 XP_016170695.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 KDP43089.1 hypothetical protein JCGZ_25275 [Jatropha curcas] 65 1e-10 XP_019414244.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_012066124.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_015932553.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 GAV57466.1 PPR domain-containing protein/PPR_2 domain-containing... 63 8e-10 XP_018808024.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 8e-10 XP_008237784.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-09 >KHN44278.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 524 Score = 79.3 bits (194), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GIKN+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 486 GIKNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 524 >KRH64583.1 hypothetical protein GLYMA_04G243200 [Glycine max] Length = 582 Score = 79.3 bits (194), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GIKN+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 544 GIKNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 582 >XP_003522561.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 79.3 bits (194), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GIKN+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 592 GIKNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 630 >KRH53339.1 hypothetical protein GLYMA_06G120100 [Glycine max] Length = 605 Score = 78.2 bits (191), Expect = 4e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GI+N+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 567 GIRNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 605 >XP_006581604.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 78.2 bits (191), Expect = 4e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GI+N+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 592 GIRNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 630 >KHN46962.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 817 Score = 78.2 bits (191), Expect = 4e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GI+N+VYTF SNQLQH+GGKDLYLVLNLLVWEMETEGYV Sbjct: 779 GIRNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGYV 817 >XP_004503044.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Cicer arietinum] Length = 643 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEG 111 GIKNH+YTFESNQLQH+GGKDLYL+LNLL WEMETEG Sbjct: 591 GIKNHLYTFESNQLQHYGGKDLYLLLNLLAWEMETEG 627 >GAU39230.1 hypothetical protein TSUD_396770 [Trifolium subterraneum] Length = 524 Score = 75.9 bits (185), Expect = 3e-14 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETE 108 GIKNHVYTFESNQLQH+GGKD+YL+LNLLVWEMETE Sbjct: 485 GIKNHVYTFESNQLQHYGGKDIYLLLNLLVWEMETE 520 >XP_013461348.1 PPR containing plant-like protein [Medicago truncatula] KEH35383.1 PPR containing plant-like protein [Medicago truncatula] Length = 629 Score = 75.9 bits (185), Expect = 3e-14 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETE 108 GIKNHVYTFESNQLQH+GGKD+YL+LNLLVWEMETE Sbjct: 591 GIKNHVYTFESNQLQHYGGKDIYLLLNLLVWEMETE 626 >XP_017420402.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Vigna angularis] KOM41484.1 hypothetical protein LR48_Vigan04g168200 [Vigna angularis] Length = 630 Score = 75.9 bits (185), Expect = 3e-14 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGY 114 GIKN++YTF SNQLQH+GGKDLYL+LNLLVWEMETEGY Sbjct: 592 GIKNNLYTFSSNQLQHYGGKDLYLLLNLLVWEMETEGY 629 >XP_014522307.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Vigna radiata var. radiata] Length = 630 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGY 114 GIKN++YTF SNQLQH+GGKDLYL+LNLLVWEME EGY Sbjct: 592 GIKNNLYTFSSNQLQHYGGKDLYLLLNLLVWEMENEGY 629 >XP_015888477.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Ziziphus jujuba] Length = 630 Score = 68.9 bits (167), Expect = 7e-12 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 GIKNHVYTF++++L HHGGKD+YLVL LL+W+M+ EGY+ Sbjct: 592 GIKNHVYTFKADELLHHGGKDIYLVLGLLIWQMKVEGYL 630 >XP_016170695.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Arachis ipaensis] XP_016170696.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Arachis ipaensis] Length = 630 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEG 111 GIKN VYTF SNQLQH+GG+DLYL+LNLL+WE+E EG Sbjct: 592 GIKNQVYTFASNQLQHYGGRDLYLILNLLLWEIENEG 628 >KDP43089.1 hypothetical protein JCGZ_25275 [Jatropha curcas] Length = 317 Score = 65.1 bits (157), Expect = 1e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEG 111 GI+NHVYTF+++QLQHHGGKD YL+L LL WE+E EG Sbjct: 273 GIRNHVYTFKADQLQHHGGKDTYLLLRLLDWEIENEG 309 >XP_019414244.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Lupinus angustifolius] OIV97999.1 hypothetical protein TanjilG_14099 [Lupinus angustifolius] Length = 631 Score = 65.1 bits (157), Expect = 2e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETE 108 GI NHVY+F SN L+H+GGKDLYLVLNLL+WEME+E Sbjct: 592 GIDNHVYSFASNLLEHYGGKDLYLVLNLLMWEMESE 627 >XP_012066124.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Jatropha curcas] Length = 636 Score = 65.1 bits (157), Expect = 2e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEG 111 GI+NHVYTF+++QLQHHGGKD YL+L LL WE+E EG Sbjct: 592 GIRNHVYTFKADQLQHHGGKDTYLLLRLLDWEIENEG 628 >XP_015932553.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Arachis duranensis] Length = 630 Score = 64.7 bits (156), Expect = 2e-10 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 4 IKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEG 111 IKN VY+F SNQLQH+GG+DLYL+LNLL+WE+E EG Sbjct: 593 IKNQVYSFASNQLQHYGGRDLYLILNLLLWEIENEG 628 >GAV57466.1 PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 641 Score = 63.2 bits (152), Expect = 8e-10 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 4 IKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV 117 IKN+VYTF ++QL H GGKD+YLVL LL+WEME +GYV Sbjct: 592 IKNYVYTFNADQLLHCGGKDIYLVLQLLIWEMEDDGYV 629 >XP_018808024.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Juglans regia] Length = 646 Score = 63.2 bits (152), Expect = 8e-10 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGY 114 GIKN +YTFE +QL HHGGKD+YLVL LL++EME +GY Sbjct: 592 GIKNLIYTFEEDQLLHHGGKDIYLVLRLLIFEMEDKGY 629 >XP_008237784.1 PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Prunus mume] Length = 636 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 GIKNHVYTFESNQLQHHGGKDLYLVLNLLVWEMETEGYV*N 123 GI+NHVYTF+++QLQ H GKD+YL+L LL WEME E Y N Sbjct: 593 GIQNHVYTFKADQLQPHRGKDIYLILRLLCWEMEAEDYTDN 633