BLASTX nr result
ID: Glycyrrhiza34_contig00023183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023183 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003556393.1 PREDICTED: guanine nucleotide-binding protein sub... 77 2e-16 XP_014511024.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-16 XP_014511023.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-16 XP_007143893.1 hypothetical protein PHAVU_007G111000g [Phaseolus... 76 2e-16 XP_003536197.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-16 XP_016174750.1 PREDICTED: guanine nucleotide-binding protein sub... 74 2e-15 XP_015940576.1 PREDICTED: guanine nucleotide-binding protein sub... 74 2e-15 KYP74625.1 hypothetical protein KK1_007312 [Cajanus cajan] 74 2e-15 XP_008449308.1 PREDICTED: guanine nucleotide-binding protein sub... 74 2e-15 XP_004150567.1 PREDICTED: guanine nucleotide-binding protein sub... 74 2e-15 XP_004495420.1 PREDICTED: guanine nucleotide-binding protein sub... 73 5e-15 XP_011073473.1 PREDICTED: guanine nucleotide-binding protein sub... 72 6e-15 ANK58713.1 guanine nucleotide-binding protein subunit gamma-like... 72 7e-15 XP_018818631.1 PREDICTED: guanine nucleotide-binding protein sub... 72 1e-14 XP_010279294.1 PREDICTED: guanine nucleotide-binding protein sub... 72 1e-14 XP_009376004.1 PREDICTED: guanine nucleotide-binding protein sub... 72 1e-14 XP_008341025.1 PREDICTED: guanine nucleotide-binding protein sub... 72 1e-14 XP_011462476.1 PREDICTED: guanine nucleotide-binding protein sub... 72 2e-14 XP_019449937.1 PREDICTED: guanine nucleotide-binding protein sub... 71 2e-14 XP_012849844.1 PREDICTED: guanine nucleotide-binding protein sub... 70 3e-14 >XP_003556393.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Glycine max] KHN05047.1 hypothetical protein glysoja_013954 [Glycine soja] KRG92444.1 hypothetical protein GLYMA_20G211400 [Glycine max] Length = 106 Score = 76.6 bits (187), Expect = 2e-16 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP +VGPL+PTWDRWFEG QDSK C +CWIL Sbjct: 68 VETKPDPLLPSSVGPLSPTWDRWFEGPQDSKSCCRCWIL 106 >XP_014511024.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 isoform X2 [Vigna radiata var. radiata] Length = 98 Score = 76.3 bits (186), Expect = 2e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP T+GP++PTWDRWFEG QDSK C +CWIL Sbjct: 60 VETKPDPLLPSTIGPVSPTWDRWFEGPQDSKGCCRCWIL 98 >XP_014511023.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 isoform X1 [Vigna radiata var. radiata] XP_017414645.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Vigna angularis] XP_017414647.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Vigna angularis] BAT94816.1 hypothetical protein VIGAN_08145800 [Vigna angularis var. angularis] Length = 106 Score = 76.3 bits (186), Expect = 2e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP T+GP++PTWDRWFEG QDSK C +CWIL Sbjct: 68 VETKPDPLLPSTIGPVSPTWDRWFEGPQDSKGCCRCWIL 106 >XP_007143893.1 hypothetical protein PHAVU_007G111000g [Phaseolus vulgaris] ESW15887.1 hypothetical protein PHAVU_007G111000g [Phaseolus vulgaris] Length = 106 Score = 76.3 bits (186), Expect = 2e-16 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP T+GP++PTWDRWFEG QDSK C +CWIL Sbjct: 68 VETKPDPLLPSTIGPVSPTWDRWFEGPQDSKGCCRCWIL 106 >XP_003536197.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like isoform X1 [Glycine max] KHN30552.1 hypothetical protein glysoja_029989 [Glycine soja] KRH34355.1 hypothetical protein GLYMA_10G178700 [Glycine max] Length = 106 Score = 76.3 bits (186), Expect = 2e-16 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP TVGPL+P WDRWFEG QDSK C +CWIL Sbjct: 68 VETKPDPLLPSTVGPLSPAWDRWFEGPQDSKSCCRCWIL 106 >XP_016174750.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Arachis ipaensis] Length = 105 Score = 73.9 bits (180), Expect = 2e-15 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP T+GPLNP+WDRWFEG Q+SK C +CWIL Sbjct: 68 VETRPDPLLPTTIGPLNPSWDRWFEGPQESKGC-RCWIL 105 >XP_015940576.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Arachis duranensis] Length = 105 Score = 73.9 bits (180), Expect = 2e-15 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP T+GPLNP+WDRWFEG Q+SK C +CWIL Sbjct: 68 VETRPDPLLPTTIGPLNPSWDRWFEGPQESKGC-RCWIL 105 >KYP74625.1 hypothetical protein KK1_007312 [Cajanus cajan] Length = 106 Score = 73.9 bits (180), Expect = 2e-15 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VET+PDPLLP T+GP +PTWDRWFEG +DSK C +CWIL Sbjct: 68 VETKPDPLLPSTIGPASPTWDRWFEGPKDSKGCCRCWIL 106 >XP_008449308.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis melo] Length = 103 Score = 73.6 bits (179), Expect = 2e-15 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLPLT GP+NP WDRWFEG QDSK C +CWIL Sbjct: 66 VETRPDPLLPLTHGPINPLWDRWFEGPQDSKGC-RCWIL 103 >XP_004150567.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis sativus] KGN61655.1 hypothetical protein Csa_2G215490 [Cucumis sativus] Length = 104 Score = 73.6 bits (179), Expect = 2e-15 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLPLT GP+NP WDRWFEG QDSK C +CWIL Sbjct: 67 VETRPDPLLPLTHGPINPLWDRWFEGPQDSKGC-RCWIL 104 >XP_004495420.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Cicer arietinum] Length = 108 Score = 72.8 bits (177), Expect = 5e-15 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VE RPDPLLPLT+ PLNPTWDRWFEG QDSK C +C IL Sbjct: 70 VEKRPDPLLPLTISPLNPTWDRWFEGPQDSKGCCRCRIL 108 >XP_011073473.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Sesamum indicum] Length = 99 Score = 72.4 bits (176), Expect = 6e-15 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 ++TRPDPLLPLT GP+NP WDRWFEG QDS RC +CWIL Sbjct: 62 IKTRPDPLLPLTQGPVNPMWDRWFEGPQDSSRC-RCWIL 99 >ANK58713.1 guanine nucleotide-binding protein subunit gamma-like 2 protein [Morus alba var. atropurpurea] Length = 106 Score = 72.4 bits (176), Expect = 7e-15 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP T GP+NP WDRWFEG QDSK C +CWIL Sbjct: 69 VETRPDPLLPATYGPINPLWDRWFEGPQDSKGC-RCWIL 106 >XP_018818631.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Juglans regia] XP_018818632.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Juglans regia] Length = 111 Score = 72.0 bits (175), Expect = 1e-14 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP+T GP+NP WDRWFEG QDSK C +CWIL Sbjct: 74 VETRPDPLLPVTNGPINPFWDRWFEGPQDSKGC-RCWIL 111 >XP_010279294.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Nelumbo nucifera] Length = 105 Score = 71.6 bits (174), Expect = 1e-14 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 +ETRPDPLLP+T GP NP+WDRWFEG QDSK C +CWIL Sbjct: 68 IETRPDPLLPVTNGPTNPSWDRWFEGPQDSKGC-RCWIL 105 >XP_009376004.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like isoform X1 [Pyrus x bretschneideri] XP_009376006.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like isoform X2 [Pyrus x bretschneideri] Length = 105 Score = 71.6 bits (174), Expect = 1e-14 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 227 ETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 ETRPDPLLP+T GPLNP WDRWFEG QDSK C +CWIL Sbjct: 69 ETRPDPLLPITHGPLNPFWDRWFEGPQDSKGC-RCWIL 105 >XP_008341025.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Malus domestica] Length = 105 Score = 71.6 bits (174), Expect = 1e-14 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 227 ETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 ETRPDPLLP+T GPLNP WDRWFEG QDSK C +CWIL Sbjct: 69 ETRPDPLLPITHGPLNPFWDRWFEGPQDSKGC-RCWIL 105 >XP_011462476.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Fragaria vesca subsp. vesca] Length = 108 Score = 71.6 bits (174), Expect = 2e-14 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP+T GPLNP WDRWFEG +DSK C +CWIL Sbjct: 71 VETRPDPLLPITRGPLNPFWDRWFEGPKDSKGC-RCWIL 108 >XP_019449937.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Lupinus angustifolius] Length = 101 Score = 71.2 bits (173), Expect = 2e-14 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 VETRPDPLLP+T GPLNP WDRWFEG +DSK C CWIL Sbjct: 64 VETRPDPLLPITNGPLNPLWDRWFEGPKDSKGC-SCWIL 101 >XP_012849844.1 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Erythranthe guttata] EYU26968.1 hypothetical protein MIMGU_mgv1a017061mg [Erythranthe guttata] Length = 95 Score = 70.5 bits (171), Expect = 3e-14 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -2 Query: 230 VETRPDPLLPLTVGPLNPTWDRWFEGLQDSKRCWKCWIL 114 +ETRP+PLLP+T+GP+NP WDRWFEG Q+S +C +CWIL Sbjct: 58 IETRPEPLLPVTIGPINPMWDRWFEGPQESTKC-RCWIL 95