BLASTX nr result
ID: Glycyrrhiza34_contig00023081
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023081 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP76487.1 hypothetical protein KK1_020732 [Cajanus cajan] 66 1e-10 XP_017415812.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 6e-10 BAT83167.1 hypothetical protein VIGAN_04027900 [Vigna angularis ... 64 9e-10 XP_014498256.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 9e-10 XP_007139355.1 hypothetical protein PHAVU_008G022600g [Phaseolus... 64 1e-09 GAU14071.1 hypothetical protein TSUD_168960 [Trifolium subterran... 60 1e-08 XP_006602983.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-08 XP_003530467.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 XP_007145915.1 hypothetical protein PHAVU_007G278400g [Phaseolus... 55 2e-06 XP_004491765.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 3e-06 >KYP76487.1 hypothetical protein KK1_020732 [Cajanus cajan] Length = 640 Score = 66.2 bits (160), Expect = 1e-10 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R+ I NHSQ V S SSIP FT NSTFP+NPSFRRFSSEPVLAH +D Sbjct: 14 SRHRILNHSQ---VRTSHSSIPHRFTANSTFPLNPSFRRFSSEPVLAHADTD 62 >XP_017415812.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Vigna angularis] KOM36668.1 hypothetical protein LR48_Vigan03g004900 [Vigna angularis] Length = 629 Score = 64.3 bits (155), Expect = 6e-10 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R IPNHSQ VL S SSI T NS+FP+NPSFRRFSSEPVLAH+ +D Sbjct: 14 SRPRIPNHSQ---VLSSSSSISRRLTVNSSFPLNPSFRRFSSEPVLAHSDND 62 >BAT83167.1 hypothetical protein VIGAN_04027900 [Vigna angularis var. angularis] Length = 579 Score = 63.9 bits (154), Expect = 9e-10 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R IPNHSQ VL S SSI T NS+FP+NPSFRRFSSEPVLAH+ +D Sbjct: 14 SRPRIPNHSQ---VLPSSSSISRRLTVNSSFPLNPSFRRFSSEPVLAHSDND 62 >XP_014498256.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Vigna radiata var. radiata] Length = 629 Score = 63.9 bits (154), Expect = 9e-10 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R IPNHSQ VL S SSI T NS+FP+NPSFRRFSSEPVLAH+ +D Sbjct: 14 SRPRIPNHSQ---VLPSSSSISRRLTVNSSFPLNPSFRRFSSEPVLAHSDND 62 >XP_007139355.1 hypothetical protein PHAVU_008G022600g [Phaseolus vulgaris] ESW11349.1 hypothetical protein PHAVU_008G022600g [Phaseolus vulgaris] Length = 629 Score = 63.5 bits (153), Expect = 1e-09 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R IPNHSQ VL S SSI FT NS+FP+NPSFRRFSSEPVL H+ +D Sbjct: 14 SRPCIPNHSQ---VLPSSSSISRRFTVNSSFPLNPSFRRFSSEPVLDHSDND 62 >GAU14071.1 hypothetical protein TSUD_168960 [Trifolium subterraneum] Length = 479 Score = 60.5 bits (145), Expect = 1e-08 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 151 IPNHSQHLQVLRSFSSIPSCFTTN-STFPINPSFRRFSSEPVLAHTGSD 294 IPN SQ V+RSFSSIP FT N S FPINPSFR FSSEPVLA+ D Sbjct: 18 IPNQSQ---VIRSFSSIPLSFTANQSKFPINPSFRNFSSEPVLANVDPD 63 >XP_006602983.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Glycine max] XP_014626540.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Glycine max] XP_014626541.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Glycine max] KRH01461.1 hypothetical protein GLYMA_18G278400 [Glycine max] Length = 629 Score = 60.5 bits (145), Expect = 1e-08 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +1 Query: 154 PNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 P + H QVL SSIP F NSTFP+NPSFRRFSSEPVLA +D Sbjct: 16 PRITYHSQVLPYSSSIPRRFAANSTFPLNPSFRRFSSEPVLAQADTD 62 >XP_003530467.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial-like [Glycine max] KRH45172.1 hypothetical protein GLYMA_08G255500 [Glycine max] Length = 628 Score = 59.7 bits (143), Expect = 3e-08 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = +1 Query: 142 RNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSDS 297 R+ I NHSQ VL S SSIP FT NSTF +NPSFR FSSEPVLA +D+ Sbjct: 15 RDRILNHSQ---VLPSSSSIPCRFTANSTFQLNPSFRHFSSEPVLAQADTDN 63 >XP_007145915.1 hypothetical protein PHAVU_007G278400g [Phaseolus vulgaris] ESW17909.1 hypothetical protein PHAVU_007G278400g [Phaseolus vulgaris] Length = 662 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = +1 Query: 139 ARNGIPNHSQHLQVLRSFSSIPSCFTTNSTFPINPSFRRFSSEPVLAHTGSD 294 +R IPNHS SSI FT NS+FP+NPSFRRFSSEPV+ H+ +D Sbjct: 14 SRPCIPNHSS--------SSIFRRFTVNSSFPLNPSFRRFSSEPVIDHSDND 57 >XP_004491765.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15980, mitochondrial-like [Cicer arietinum] Length = 635 Score = 53.9 bits (128), Expect = 3e-06 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 3/53 (5%) Frame = +1 Query: 145 NGIPNHSQHLQVLRSFSSIPSCFTTN---STFPINPSFRRFSSEPVLAHTGSD 294 + IPN Q VLRSFSSIP F TN S F INP+FR FSSEPVLA+ D Sbjct: 17 HNIPNQPQ---VLRSFSSIPHRFNTNHSNSKFTINPNFRHFSSEPVLANVEPD 66