BLASTX nr result
ID: Glycyrrhiza34_contig00022903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022903 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004512681.1 PREDICTED: uncharacterized protein LOC101496834 [... 62 5e-09 XP_013452641.1 DUF1308 family protein [Medicago truncatula] KEH2... 58 9e-08 XP_013452640.1 DUF1308 family protein [Medicago truncatula] KEH2... 58 9e-08 XP_003619781.1 DUF1308 family protein [Medicago truncatula] AES7... 58 9e-08 >XP_004512681.1 PREDICTED: uncharacterized protein LOC101496834 [Cicer arietinum] Length = 509 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 205 MEKEEHRVAQVEVAKQRCKCVIDAIHQLPSS 297 MEKE+HRVAQVE+AKQRC CVIDAIHQLPSS Sbjct: 1 MEKEDHRVAQVELAKQRCACVIDAIHQLPSS 31 >XP_013452641.1 DUF1308 family protein [Medicago truncatula] KEH26669.1 DUF1308 family protein [Medicago truncatula] Length = 443 Score = 58.2 bits (139), Expect = 9e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 205 MEKEEHRVAQVEVAKQRCKCVIDAIHQLPSS 297 MEKEEHR+AQVE+AKQRC CVID+I QLPSS Sbjct: 1 MEKEEHRIAQVEIAKQRCICVIDSIQQLPSS 31 >XP_013452640.1 DUF1308 family protein [Medicago truncatula] KEH26668.1 DUF1308 family protein [Medicago truncatula] Length = 445 Score = 58.2 bits (139), Expect = 9e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 205 MEKEEHRVAQVEVAKQRCKCVIDAIHQLPSS 297 MEKEEHR+AQVE+AKQRC CVID+I QLPSS Sbjct: 1 MEKEEHRIAQVEIAKQRCICVIDSIQQLPSS 31 >XP_003619781.1 DUF1308 family protein [Medicago truncatula] AES75999.1 DUF1308 family protein [Medicago truncatula] Length = 511 Score = 58.2 bits (139), Expect = 9e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 205 MEKEEHRVAQVEVAKQRCKCVIDAIHQLPSS 297 MEKEEHR+AQVE+AKQRC CVID+I QLPSS Sbjct: 1 MEKEEHRIAQVEIAKQRCICVIDSIQQLPSS 31