BLASTX nr result
ID: Glycyrrhiza34_contig00022785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022785 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013455525.1 formin-like 2 domain protein [Medicago truncatula... 55 5e-07 >XP_013455525.1 formin-like 2 domain protein [Medicago truncatula] KEH29556.1 formin-like 2 domain protein [Medicago truncatula] Length = 860 Score = 54.7 bits (130), Expect = 5e-07 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 4/63 (6%) Frame = +2 Query: 2 CKEVRDTTLXXXXXXXXXXXXXXPS-SMPSSPDTR---QQSSPLAPPSDLHRRLFPAIAG 169 CKEV++ L PS ++PSSPDTR + P PPSDLHRRLFPAIAG Sbjct: 788 CKEVKEAALKSMKGSWKKEA---PSVAVPSSPDTRHHPESPQPPPPPSDLHRRLFPAIAG 844 Query: 170 RRV 178 RRV Sbjct: 845 RRV 847