BLASTX nr result
ID: Glycyrrhiza34_contig00022727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022727 (458 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004502524.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 GAU47648.1 hypothetical protein TSUD_27720 [Trifolium subterraneum] 55 8e-06 >XP_004502524.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Cicer arietinum] XP_004502526.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Cicer arietinum] XP_012571892.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Cicer arietinum] Length = 480 Score = 55.1 bits (131), Expect = 5e-06 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -3 Query: 171 MIKILDRRKKPLLRQFVSFSRTLITSEEEAIHEEVPDVTETVCKVMMSSPTVTLDAA 1 MIKI D RK LL+ VSF++TL TSE IH+ + DVTET+ KVMMS+P VTLD A Sbjct: 1 MIKISDHRKNLLLK-CVSFAKTLSTSEP--IHD-IADVTETLYKVMMSNPAVTLDTA 53 >GAU47648.1 hypothetical protein TSUD_27720 [Trifolium subterraneum] Length = 521 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 5/91 (5%) Frame = +1 Query: 139 WFFSAVENLNHCVLAEEESWKFHLMIR*QHQRDLLRREWRIWIEHTLREGNFAAE----- 303 W +S E + + W + I + +D+L REWR+ I HT REGN A+ Sbjct: 430 WCYSDSETAIKLITEPVDEWHHYAAIL-LNIKDILAREWRVNIAHTFREGNACADYLAKL 488 Query: 304 GLTQREPIHILHSPPVTLRAVLLADA*GVHF 396 G E + ++ +PP +L +LLADA G F Sbjct: 489 GACNNEALSVMTNPPASLNLLLLADASGTWF 519