BLASTX nr result
ID: Glycyrrhiza34_contig00022626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022626 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU65585.1 hypothetical protein LE_TR16044_c1_g1_i1_g.51091 [Noc... 55 3e-08 JAU34038.1 hypothetical protein LC_TR15320_c1_g1_i1_g.51790 [Noc... 55 3e-08 JAU92792.1 hypothetical protein MP_TR25186_c1_g1_i1_g.72999 [Noc... 55 3e-08 >JAU65585.1 hypothetical protein LE_TR16044_c1_g1_i1_g.51091 [Noccaea caerulescens] Length = 87 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 122 WEMERLELSASRATVFELSVKPFDNTPNSI-KKGLYSGLPC 3 WEMER ELSAS++++ VKP+DNTP I K GLYSGLPC Sbjct: 19 WEMERNELSASKSSMNRSLVKPYDNTPTQILKGGLYSGLPC 59 >JAU34038.1 hypothetical protein LC_TR15320_c1_g1_i1_g.51790 [Noccaea caerulescens] Length = 87 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 122 WEMERLELSASRATVFELSVKPFDNTPNSI-KKGLYSGLPC 3 WEMER ELSAS++++ VKP+DNTP I K GLYSGLPC Sbjct: 19 WEMERNELSASKSSMNRSLVKPYDNTPTQILKGGLYSGLPC 59 >JAU92792.1 hypothetical protein MP_TR25186_c1_g1_i1_g.72999 [Noccaea caerulescens] Length = 95 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 122 WEMERLELSASRATVFELSVKPFDNTPNSI-KKGLYSGLPC 3 WEMER ELSAS++++ VKP+DNTP I K GLYSGLPC Sbjct: 19 WEMERNELSASKSSMNRSLVKPYDNTPTQILKGGLYSGLPC 59