BLASTX nr result
ID: Glycyrrhiza34_contig00021653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00021653 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007156548.1 hypothetical protein PHAVU_003G295400g [Phaseolus... 154 2e-45 BAT75071.1 hypothetical protein VIGAN_01287200 [Vigna angularis ... 152 9e-45 XP_014508171.1 PREDICTED: cyclin-dependent kinase inhibitor 7 is... 149 1e-43 XP_003529390.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 145 4e-42 XP_014508170.1 PREDICTED: cyclin-dependent kinase inhibitor 7 is... 142 9e-41 KYP76343.1 Cyclin-dependent kinase inhibitor 7, partial [Cajanus... 138 1e-39 XP_017417403.1 PREDICTED: cyclin-dependent kinase inhibitor 7 [V... 135 1e-38 NP_001235878.1 uncharacterized protein LOC100306496 [Glycine max... 135 4e-38 KHN37497.1 Cyclin-dependent kinase inhibitor 7 [Glycine soja] 117 4e-31 XP_016182207.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 112 1e-28 XP_019422901.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 110 1e-28 XP_015944624.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 111 2e-28 XP_019445779.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 104 4e-26 XP_004505202.1 PREDICTED: cyclin-dependent kinase inhibitor 4 [C... 99 1e-23 XP_018835572.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 99 1e-23 XP_018841962.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 98 4e-23 XP_011092584.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 97 5e-23 OMO63208.1 Cyclin-dependent kinase inhibitor [Corchorus olitorius] 97 9e-23 XP_018501560.1 PREDICTED: cyclin-dependent kinase inhibitor 7-li... 96 9e-23 OMO74122.1 Cyclin-dependent kinase inhibitor [Corchorus capsularis] 95 5e-22 >XP_007156548.1 hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] ESW28542.1 hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] Length = 191 Score = 154 bits (389), Expect = 2e-45 Identities = 73/91 (80%), Positives = 82/91 (90%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 FETVDS NRNFKS SLLSEF GDSEE++MFPAKSSA V+++R++K PP AEIEEFF AE Sbjct: 101 FETVDSANRNFKSSSLLSEFCGDSEESTMFPAKSSAEVNEKRRVKEPPKAEIEEFFVMAE 160 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 ++EQKRF EKYNFDIVRDMPLEGRYQWVRLH Sbjct: 161 KYEQKRFVEKYNFDIVRDMPLEGRYQWVRLH 191 >BAT75071.1 hypothetical protein VIGAN_01287200 [Vigna angularis var. angularis] Length = 189 Score = 152 bits (384), Expect = 9e-45 Identities = 73/91 (80%), Positives = 82/91 (90%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 F+TV STN NFKS SLLSEFSGDSEE++MFPAKSSA V+++RK+K PP AEIEEFFA AE Sbjct: 99 FKTVHSTNHNFKSSSLLSEFSGDSEESTMFPAKSSAEVTEKRKVKEPPKAEIEEFFAMAE 158 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 ++EQKRF EKYNFDIVRD PLEGRYQWVRLH Sbjct: 159 KYEQKRFVEKYNFDIVRDTPLEGRYQWVRLH 189 >XP_014508171.1 PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X2 [Vigna radiata var. radiata] Length = 181 Score = 149 bits (376), Expect = 1e-43 Identities = 72/91 (79%), Positives = 81/91 (89%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 F+TV ST NFKS SLLSEFSGDSEE++MFPAKSSA V+++RK+K P AEIEEFFA AE Sbjct: 91 FKTVHSTKHNFKSSSLLSEFSGDSEESTMFPAKSSAEVTEKRKVKEPAKAEIEEFFAMAE 150 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 ++EQKRF EKYNFDIVRDMPLEGRYQWVRLH Sbjct: 151 KYEQKRFVEKYNFDIVRDMPLEGRYQWVRLH 181 >XP_003529390.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Glycine max] KHN31063.1 Cyclin-dependent kinase inhibitor 7 [Glycine soja] KRH50258.1 hypothetical protein GLYMA_07G211300 [Glycine max] Length = 187 Score = 145 bits (366), Expect = 4e-42 Identities = 75/92 (81%), Positives = 82/92 (89%), Gaps = 1/92 (1%) Frame = -1 Query: 338 FETV-DSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATA 162 FETV DST+ NFKSFSLLSEFSGDSEE++M PAKSSAAV K+KTPP AEIEEFFA A Sbjct: 99 FETVEDSTSLNFKSFSLLSEFSGDSEESAMIPAKSSAAVL---KVKTPPKAEIEEFFAMA 155 Query: 161 ERHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 E++EQKRF EKYNFDIVRD+PLEGRYQWVRLH Sbjct: 156 EKYEQKRFTEKYNFDIVRDLPLEGRYQWVRLH 187 >XP_014508170.1 PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X1 [Vigna radiata var. radiata] Length = 205 Score = 142 bits (359), Expect = 9e-41 Identities = 69/88 (78%), Positives = 78/88 (88%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 F+TV ST NFKS SLLSEFSGDSEE++MFPAKSSA V+++RK+K P AEIEEFFA AE Sbjct: 91 FKTVHSTKHNFKSSSLLSEFSGDSEESTMFPAKSSAEVTEKRKVKEPAKAEIEEFFAMAE 150 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWV 75 ++EQKRF EKYNFDIVRDMPLEGRYQWV Sbjct: 151 KYEQKRFVEKYNFDIVRDMPLEGRYQWV 178 >KYP76343.1 Cyclin-dependent kinase inhibitor 7, partial [Cajanus cajan] Length = 144 Score = 138 bits (347), Expect = 1e-39 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 3/93 (3%) Frame = -1 Query: 335 ETVDS---TNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFAT 165 ET+DS TN N KSFS+L+EFSGDSEE++MFPA A S RRK++TPP AEIEEFFA Sbjct: 56 ETLDSSHSTNGNLKSFSVLNEFSGDSEESTMFPA----AESGRRKVETPPSAEIEEFFAM 111 Query: 164 AERHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 AE++EQKRFAEKYNFDIVRDMPLEGRYQWVRLH Sbjct: 112 AEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 144 >XP_017417403.1 PREDICTED: cyclin-dependent kinase inhibitor 7 [Vigna angularis] Length = 132 Score = 135 bits (339), Expect = 1e-38 Identities = 66/88 (75%), Positives = 76/88 (86%) Frame = -1 Query: 329 VDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAERHE 150 +D + FKS LLSEFSGDSEE++MFPAKSSA V+++RK+K PP AEIEEFFA AE++E Sbjct: 47 LDLQTKGFKS--LLSEFSGDSEESTMFPAKSSAEVTEKRKVKEPPKAEIEEFFAMAEKYE 104 Query: 149 QKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 QKRF EKYNFDIVRD PLEGRYQWVRLH Sbjct: 105 QKRFVEKYNFDIVRDTPLEGRYQWVRLH 132 >NP_001235878.1 uncharacterized protein LOC100306496 [Glycine max] ACU14700.1 unknown [Glycine max] KRH71159.1 hypothetical protein GLYMA_02G133700 [Glycine max] Length = 176 Score = 135 bits (339), Expect = 4e-38 Identities = 72/92 (78%), Positives = 79/92 (85%), Gaps = 1/92 (1%) Frame = -1 Query: 338 FETV-DSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATA 162 F+TV DSTNR FK FSLLSEFSGDSEE+ AKSSAAV RK+KTPP AEIEEFFA A Sbjct: 92 FQTVEDSTNRYFKPFSLLSEFSGDSEES----AKSSAAV---RKLKTPPQAEIEEFFAMA 144 Query: 161 ERHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 E++E+KRF EKYNFDIVRD+PLEGRYQWVRLH Sbjct: 145 EKYERKRFTEKYNFDIVRDLPLEGRYQWVRLH 176 >KHN37497.1 Cyclin-dependent kinase inhibitor 7 [Glycine soja] Length = 163 Score = 117 bits (292), Expect = 4e-31 Identities = 61/80 (76%), Positives = 67/80 (83%) Frame = -1 Query: 305 KSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAERHEQKRFAEKY 126 K LLSEFSGDSEE+ AKSSAAV RK+KTPP AEIEEFFA AE++E+KRF EKY Sbjct: 91 KKGQLLSEFSGDSEES----AKSSAAV---RKLKTPPQAEIEEFFAMAEKYERKRFTEKY 143 Query: 125 NFDIVRDMPLEGRYQWVRLH 66 NFDIVRD+PLEGRYQWVRLH Sbjct: 144 NFDIVRDLPLEGRYQWVRLH 163 >XP_016182207.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Arachis ipaensis] Length = 207 Score = 112 bits (279), Expect = 1e-28 Identities = 59/90 (65%), Positives = 67/90 (74%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 F TVDST NFKS SLLSE GDSEE++ + + +K K P + EIEEFFA AE Sbjct: 118 FVTVDSTFHNFKSISLLSEQCGDSEESAAVVRQHEQKSTAAKKEKVPEV-EIEEFFAMAE 176 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 ++EQKRFAEKYNFDIV DMPLEGRYQWVRL Sbjct: 177 KYEQKRFAEKYNFDIVADMPLEGRYQWVRL 206 >XP_019422901.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Lupinus angustifolius] OIV93275.1 hypothetical protein TanjilG_23116 [Lupinus angustifolius] Length = 161 Score = 110 bits (275), Expect = 1e-28 Identities = 58/90 (64%), Positives = 66/90 (73%) Frame = -1 Query: 335 ETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAER 156 ETV ST+ NFKS+SLLSEF GDSEET +R +K PP EIEEF A AE+ Sbjct: 85 ETV-STHLNFKSYSLLSEFCGDSEET------------MKRSLKMPPKEEIEEFLAVAEK 131 Query: 155 HEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 +EQKRF+EKYNFDI DMPLEGRYQWVRL+ Sbjct: 132 YEQKRFSEKYNFDIATDMPLEGRYQWVRLN 161 >XP_015944624.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Arachis duranensis] Length = 207 Score = 111 bits (277), Expect = 2e-28 Identities = 59/90 (65%), Positives = 67/90 (74%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 F TVDST NFKS SLLSE GDSEE++ + + +K K P + EIEEFFA AE Sbjct: 118 FVTVDSTFHNFKSSSLLSEQCGDSEESAAVVRQHEQKSTAAKKEKVPEV-EIEEFFAMAE 176 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 ++EQKRFAEKYNFDIV DMPLEGRYQWVRL Sbjct: 177 KYEQKRFAEKYNFDIVADMPLEGRYQWVRL 206 >XP_019445779.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Lupinus angustifolius] OIW10178.1 hypothetical protein TanjilG_27929 [Lupinus angustifolius] Length = 163 Score = 104 bits (259), Expect = 4e-26 Identities = 56/91 (61%), Positives = 64/91 (70%) Frame = -1 Query: 338 FETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAE 159 FETVDST+ NFK SLLSEFSGDSEET M P+ +K P EIEEF AE Sbjct: 85 FETVDSTHLNFKPVSLLSEFSGDSEET-MTPS-----------VKMAPKEEIEEFLTMAE 132 Query: 158 RHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 ++EQKRFA KYNFDI D P+EGRY+WVRL+ Sbjct: 133 KYEQKRFAMKYNFDIATDTPMEGRYEWVRLN 163 >XP_004505202.1 PREDICTED: cyclin-dependent kinase inhibitor 4 [Cicer arietinum] Length = 197 Score = 99.0 bits (245), Expect = 1e-23 Identities = 54/90 (60%), Positives = 60/90 (66%) Frame = -1 Query: 335 ETVDSTNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFFATAER 156 ETVDST RN KSFSLL+ +GDS+ +F P E +EFFA AER Sbjct: 122 ETVDSTKRNLKSFSLLN--NGDSKPRVLFTGNR------------PTEEETDEFFAKAER 167 Query: 155 HEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 EQKRFAEKYNFDIVR MPLEGRY+WVRLH Sbjct: 168 EEQKRFAEKYNFDIVRGMPLEGRYEWVRLH 197 >XP_018835572.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Juglans regia] Length = 224 Score = 99.4 bits (246), Expect = 1e-23 Identities = 56/94 (59%), Positives = 62/94 (65%), Gaps = 4/94 (4%) Frame = -1 Query: 338 FETVDSTNRNFKSFSL----LSEFSGDSEETSMFPAKSSAAVSQRRKMKTPPMAEIEEFF 171 FETVDS + FS SE G+SEE K S+A KTPP EIEEFF Sbjct: 136 FETVDSACIDNTKFSRETTPSSELCGESEEIDSLARKPSSA-------KTPPKEEIEEFF 188 Query: 170 ATAERHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 A AE+ EQKRFAEKYN+DIV+DMPLEGRYQWVRL Sbjct: 189 AKAEKQEQKRFAEKYNYDIVKDMPLEGRYQWVRL 222 >XP_018841962.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Juglans regia] Length = 208 Score = 97.8 bits (242), Expect = 4e-23 Identities = 52/95 (54%), Positives = 66/95 (69%), Gaps = 5/95 (5%) Frame = -1 Query: 338 FETVDST---NRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKM--KTPPMAEIEEF 174 FETVDST N+ + + S+ GDS+E K SA + + K PP EIEEF Sbjct: 112 FETVDSTYINNKLSRETTPSSDLCGDSDEMDSLARKPSAENHRPSILVAKAPPKEEIEEF 171 Query: 173 FATAERHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 FATA+++EQKRFAEKYN+DIV+D+P+EGRYQWVRL Sbjct: 172 FATADKYEQKRFAEKYNYDIVKDVPMEGRYQWVRL 206 >XP_011092584.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Sesamum indicum] XP_011092585.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like [Sesamum indicum] Length = 191 Score = 97.1 bits (240), Expect = 5e-23 Identities = 54/102 (52%), Positives = 65/102 (63%), Gaps = 12/102 (11%) Frame = -1 Query: 335 ETVDSTNRNFKSFSLLSEFSGDSEE-----TSMFPAKSSAAVSQRRK-------MKTPPM 192 E S N F+ E S DSEE +S P+K S+ V+ KTPP Sbjct: 89 EISTSINGIFREAIPKGELSADSEEFMVMDSSSAPSKKSSLVAPTSYGKFPASVAKTPPA 148 Query: 191 AEIEEFFATAERHEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 66 AE+EEFFA AE++EQKRFAEKYN+DIV+D+PLEGRYQWVRLH Sbjct: 149 AELEEFFAAAEKYEQKRFAEKYNYDIVKDVPLEGRYQWVRLH 190 >OMO63208.1 Cyclin-dependent kinase inhibitor [Corchorus olitorius] Length = 200 Score = 96.7 bits (239), Expect = 9e-23 Identities = 53/97 (54%), Positives = 66/97 (68%), Gaps = 7/97 (7%) Frame = -1 Query: 338 FETVDSTNRNFKSFSL----LSEFSGDSEETSM---FPAKSSAAVSQRRKMKTPPMAEIE 180 FET ST N FS LSE GDSEE P+ S ++ S ++ KTP AEI+ Sbjct: 102 FETEISTCININKFSRETTPLSERCGDSEEMESPEKKPSLSPSSPSSAKQPKTPSQAEID 161 Query: 179 EFFATAERHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 +FF AE++EQKRFAEKYN+DIV+D+PL+GRYQWVRL Sbjct: 162 DFFTAAEKYEQKRFAEKYNYDIVKDVPLDGRYQWVRL 198 >XP_018501560.1 PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform X2 [Pyrus x bretschneideri] Length = 186 Score = 96.3 bits (238), Expect = 9e-23 Identities = 51/87 (58%), Positives = 61/87 (70%), Gaps = 3/87 (3%) Frame = -1 Query: 320 TNRNFKSFSLLSEFSGDSEETSMFPAKSSAAVSQRRKM---KTPPMAEIEEFFATAERHE 150 TN F+ + LSE S DS E S + AVS RR++ K+PP EIEEFFA AE++E Sbjct: 102 TNNKFRETTPLSELSLDSNEMS----SPAPAVSHRRRIPVSKSPPSEEIEEFFAAAEKYE 157 Query: 149 QKRFAEKYNFDIVRDMPLEGRYQWVRL 69 KRF EKYN+DIV D+PLEGRYQWVRL Sbjct: 158 HKRFTEKYNYDIVNDVPLEGRYQWVRL 184 >OMO74122.1 Cyclin-dependent kinase inhibitor [Corchorus capsularis] Length = 199 Score = 94.7 bits (234), Expect = 5e-22 Identities = 53/96 (55%), Positives = 64/96 (66%), Gaps = 6/96 (6%) Frame = -1 Query: 338 FETVDSTNRNFKSFSL----LSEFSGDSEETSMFPAKSSAAVS--QRRKMKTPPMAEIEE 177 FET ST N FS LSE GDSEE K S + S ++ KTP AEI++ Sbjct: 102 FETEISTCININKFSRETTPLSERCGDSEEMESPEKKPSLSPSPSSAKQPKTPSQAEIDD 161 Query: 176 FFATAERHEQKRFAEKYNFDIVRDMPLEGRYQWVRL 69 FF AE++EQKRFAEKYN+DIV+D+PL+GRYQWVRL Sbjct: 162 FFTAAEKYEQKRFAEKYNYDIVKDVPLDGRYQWVRL 197