BLASTX nr result
ID: Glycyrrhiza34_contig00021543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00021543 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493071.1 PREDICTED: putative pentatricopeptide repeat-cont... 91 2e-19 GAU24689.1 hypothetical protein TSUD_322980 [Trifolium subterran... 91 3e-19 GAU32848.1 hypothetical protein TSUD_209160 [Trifolium subterran... 86 2e-17 XP_003553304.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 1e-11 XP_007161628.1 hypothetical protein PHAVU_001G085300g [Phaseolus... 64 5e-10 KYP42052.1 Putative pentatricopeptide repeat-containing protein ... 62 9e-10 KRH06837.1 hypothetical protein GLYMA_16G049100 [Glycine max] 63 2e-09 XP_017428895.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 2e-09 KHM99218.1 Putative pentatricopeptide repeat-containing protein ... 62 2e-09 XP_014504748.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 4e-09 BAT82277.1 hypothetical protein VIGAN_03226100 [Vigna angularis ... 60 1e-08 XP_017419312.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 4e-08 XP_019429659.1 PREDICTED: putative pentatricopeptide repeat-cont... 56 4e-07 XP_016162051.1 PREDICTED: putative pentatricopeptide repeat-cont... 52 1e-05 >XP_004493071.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cicer arietinum] Length = 812 Score = 91.3 bits (225), Expect = 2e-19 Identities = 51/71 (71%), Positives = 56/71 (78%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIKPCTR+ ++N+V LTAPK HLHVDASI+K NT SNF LLKAFLQ GDLS Sbjct: 1 MNYIKPCTRK---INNVVTLTAPKYHLHVDASIIKTGFDPNTYRSNF-LLKAFLQRGDLS 56 Query: 33 GARKLFDEMPH 1 ARKLFDEMPH Sbjct: 57 HARKLFDEMPH 67 >GAU24689.1 hypothetical protein TSUD_322980 [Trifolium subterraneum] Length = 538 Score = 90.5 bits (223), Expect = 3e-19 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIKPCTR+ ++NLV LTAPKPH+HVDASIVK NT SNF L+ FLQ GDL Sbjct: 1 MNYIKPCTRK---INNLVTLTAPKPHIHVDASIVKTGFDPNTYRSNF-LVNTFLQRGDLI 56 Query: 33 GARKLFDEMPH 1 GARKLFDE+PH Sbjct: 57 GARKLFDEIPH 67 >GAU32848.1 hypothetical protein TSUD_209160 [Trifolium subterraneum] Length = 641 Score = 85.5 bits (210), Expect = 2e-17 Identities = 47/71 (66%), Positives = 53/71 (74%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIKPCT++ + NLV LTAPKPHLHVDASI+K NT SNF LL FL+ GDL Sbjct: 1 MNYIKPCTKK---IINLVTLTAPKPHLHVDASIIKTGFNPNTYRSNF-LLNTFLKRGDLI 56 Query: 33 GARKLFDEMPH 1 ARKLFDE+PH Sbjct: 57 AARKLFDEIPH 67 >XP_003553304.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Glycine max] KRG94690.1 hypothetical protein GLYMA_19G102300 [Glycine max] Length = 815 Score = 68.6 bits (166), Expect = 1e-11 Identities = 41/72 (56%), Positives = 49/72 (68%), Gaps = 6/72 (8%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHL-HVDASIVK-----NTRSSNFQLLKAFLQCGDL 37 MN IK CTR+ + +HNL LT+PK H HVDAS++K NT NFQ+ + LQ GDL Sbjct: 1 MNLIKSCTRKTH-LHNLGTLTSPKRHFQHVDASMIKTGFDPNTCRFNFQV-QTHLQRGDL 58 Query: 36 SGARKLFDEMPH 1 ARKLFDEMPH Sbjct: 59 GAARKLFDEMPH 70 >XP_007161628.1 hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] ESW33622.1 hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] Length = 862 Score = 64.3 bits (155), Expect = 5e-10 Identities = 39/72 (54%), Positives = 43/72 (59%), Gaps = 5/72 (6%) Frame = -1 Query: 201 SMNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDL 37 SMNYIK CTR+N LT K H VDASI+K NT NFQ+ K + GDL Sbjct: 53 SMNYIKACTRKNGT------LTFQKRHFQVDASIIKTGFDPNTYRFNFQV-KTHILHGDL 105 Query: 36 SGARKLFDEMPH 1 ARKLFDEMPH Sbjct: 106 GAARKLFDEMPH 117 >KYP42052.1 Putative pentatricopeptide repeat-containing protein At2g01510 family [Cajanus cajan] Length = 223 Score = 62.4 bits (150), Expect = 9e-10 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVKN-----TRSSNFQLLKAFLQCGDLS 34 MNY+K CTR ++ + L +PK H VDASI+K T SNFQ+ K LQ G+L Sbjct: 1 MNYVKACTR----INGIGTLASPKRHFQVDASIIKRGFDLTTYRSNFQV-KTLLQRGNLD 55 Query: 33 GARKLFDEMPH 1 A KLFDEMPH Sbjct: 56 AALKLFDEMPH 66 >KRH06837.1 hypothetical protein GLYMA_16G049100 [Glycine max] Length = 765 Score = 62.8 bits (151), Expect = 2e-09 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MN+IK CTR A + ++PK HL+VDAS++K NT NFQ+ + LQ GDL Sbjct: 1 MNHIKSCTRNLGA-----LTSSPKRHLYVDASMIKTGFDPNTYRYNFQV-QIHLQRGDLG 54 Query: 33 GARKLFDEMPH 1 ARKLFDEMPH Sbjct: 55 AARKLFDEMPH 65 >XP_017428895.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Vigna angularis] Length = 582 Score = 62.4 bits (150), Expect = 2e-09 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 5/76 (6%) Frame = -1 Query: 213 FVTISMNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQ 49 F SMNYIK C+R+N +LT K H VDASI+K NT NFQ+ K L Sbjct: 219 FRLCSMNYIKACSRKNG------ILTLQKRHFQVDASIIKTGFDPNTYRFNFQV-KNHLL 271 Query: 48 CGDLSGARKLFDEMPH 1 GDL ARKLFD+MPH Sbjct: 272 HGDLGAARKLFDKMPH 287 >KHM99218.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 765 Score = 62.4 bits (150), Expect = 2e-09 Identities = 40/72 (55%), Positives = 47/72 (65%), Gaps = 6/72 (8%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTA-PKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDL 37 MN+IK CTR NL LT+ PK HL+VDAS++K NT NFQ+ + LQ GDL Sbjct: 1 MNHIKSCTR------NLGTLTSSPKRHLYVDASMIKTGFDPNTYRYNFQV-QIHLQRGDL 53 Query: 36 SGARKLFDEMPH 1 ARKLFDEMPH Sbjct: 54 GAARKLFDEMPH 65 >XP_014504748.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Vigna radiata var. radiata] Length = 809 Score = 61.6 bits (148), Expect = 4e-09 Identities = 38/71 (53%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIK C+R+N +LT K H VDASI+K NT NFQ+ K L GDL Sbjct: 1 MNYIKACSRKNG------ILTFQKRHFQVDASIIKTGFDPNTYRFNFQV-KNHLLHGDLG 53 Query: 33 GARKLFDEMPH 1 ARKLFDEMPH Sbjct: 54 AARKLFDEMPH 64 >BAT82277.1 hypothetical protein VIGAN_03226100 [Vigna angularis var. angularis] Length = 819 Score = 60.5 bits (145), Expect = 1e-08 Identities = 37/71 (52%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIK C+R+N +LT K H VDASI+K NT NFQ+ K L GDL Sbjct: 1 MNYIKACSRKNG------ILTLQKRHFQVDASIIKTGFDPNTYRFNFQV-KNHLLHGDLG 53 Query: 33 GARKLFDEMPH 1 ARKLFD+MPH Sbjct: 54 AARKLFDKMPH 64 >XP_017419312.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Vigna angularis] KOM38328.1 hypothetical protein LR48_Vigan03g171000 [Vigna angularis] Length = 804 Score = 58.9 bits (141), Expect = 4e-08 Identities = 37/70 (52%), Positives = 42/70 (60%), Gaps = 5/70 (7%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPKPHLHVDASIVK-----NTRSSNFQLLKAFLQCGDLS 34 MNYIK C+R+N +LT K H VDASI+K NT NFQ+ K L GDL Sbjct: 1 MNYIKACSRKNG------ILTFQKQHFQVDASIIKTGFDPNTYRFNFQV-KNHLLHGDLD 53 Query: 33 GARKLFDEMP 4 ARKLFDEMP Sbjct: 54 AARKLFDEMP 63 >XP_019429659.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Lupinus angustifolius] Length = 822 Score = 55.8 bits (133), Expect = 4e-07 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 12/78 (15%) Frame = -1 Query: 198 MNYIKPCTRRNNAVHNLVMLTAPK---PHLHV----DASIVK-----NTRSSNFQLLKAF 55 MN +KPCTR+N + + + PK PHL V DASI+K NT SNFQ+ Sbjct: 1 MNRMKPCTRKNTLQNLAIFSSQPKSSKPHLQVENPIDASIIKTGFNPNTCRSNFQV-NTH 59 Query: 54 LQCGDLSGARKLFDEMPH 1 +Q G+L+ ARKLFD+M H Sbjct: 60 VQRGELTHARKLFDKMTH 77 >XP_016162051.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Arachis ipaensis] XP_016162052.1 PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Arachis ipaensis] Length = 815 Score = 52.0 bits (123), Expect = 1e-05 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 9/72 (12%) Frame = -1 Query: 189 IKPCTRRNNAVHNLVMLTAPKPHLHV----DASIVKN-----TRSSNFQLLKAFLQCGDL 37 +K CT++ + + LT PKPHLHV DASI+K T NF L++A +Q G+L Sbjct: 1 MKACTKKISC-RSFAKLTHPKPHLHVRTPIDASIIKTGFMPQTCRFNF-LIRACVQRGEL 58 Query: 36 SGARKLFDEMPH 1 ARKLFD MPH Sbjct: 59 RRARKLFDGMPH 70