BLASTX nr result
ID: Glycyrrhiza34_contig00021469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00021469 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABN08698.1 RNA-directed DNA polymerase ; Ribonuclease H, putativ... 53 2e-07 ABD28627.2 RNA-directed DNA polymerase (Reverse transcriptase); ... 55 3e-07 GAU50246.1 hypothetical protein TSUD_188980 [Trifolium subterran... 54 1e-06 ABO80459.1 RNA-directed DNA polymerase (Reverse transcriptase); ... 53 2e-06 ABE80156.1 Ribonuclease H [Medicago truncatula] 52 6e-06 GAU18899.1 hypothetical protein TSUD_228890 [Trifolium subterran... 52 6e-06 GAU20604.1 hypothetical protein TSUD_33400 [Trifolium subterraneum] 52 6e-06 >ABN08698.1 RNA-directed DNA polymerase ; Ribonuclease H, putative [Medicago truncatula] Length = 86 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/56 (42%), Positives = 30/56 (53%) Frame = +2 Query: 26 LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLLHCIRDC 193 L+WL H+SVPT+S+L+H I PTA C C ET LHC+ DC Sbjct: 28 LVWLACHNSVPTISLLNHRNIAPTATC------------SRCNLHVETFLHCVHDC 71 >ABD28627.2 RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H [Medicago truncatula] Length = 1296 Score = 55.5 bits (132), Expect = 3e-07 Identities = 27/66 (40%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +2 Query: 5 ETTCPRK---LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLL 175 + T P K LIWL H++ PTLS+LHH + P A C C DE+ L Sbjct: 982 QLTAPEKYKLLIWLACHNAAPTLSLLHHRKMAPAATC------------SRCGENDESFL 1029 Query: 176 HCIRDC 193 HC+RDC Sbjct: 1030 HCVRDC 1035 >GAU50246.1 hypothetical protein TSUD_188980 [Trifolium subterraneum] Length = 458 Score = 53.5 bits (127), Expect = 1e-06 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 2 LETTCPRK---LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETL 172 LE P K L WL H+SVPTLS+LHH + P++ C C +ET Sbjct: 144 LELHLPEKIKFLFWLACHNSVPTLSLLHHRRMNPSSNC------------PRCCTHEETF 191 Query: 173 LHCIRDCPCVR 205 LHC+RDC R Sbjct: 192 LHCVRDCDLSR 202 >ABO80459.1 RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H [Medicago truncatula] Length = 869 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/57 (43%), Positives = 31/57 (54%) Frame = +2 Query: 26 LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLLHCIRDCP 196 LIWL HDS+PT ++LHH I +A C C DE++ HCIRDCP Sbjct: 566 LIWLACHDSLPTAALLHHRQIIASATC------------ARCGVSDESVFHCIRDCP 610 >ABE80156.1 Ribonuclease H [Medicago truncatula] Length = 438 Score = 51.6 bits (122), Expect = 6e-06 Identities = 25/56 (44%), Positives = 29/56 (51%) Frame = +2 Query: 26 LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLLHCIRDC 193 LIWL + VPTLS+LH I P+ C C EDET LHC+RDC Sbjct: 135 LIWLACQNVVPTLSLLHRRNIAPSPTC------------ARCGEEDETFLHCVRDC 178 >GAU18899.1 hypothetical protein TSUD_228890 [Trifolium subterraneum] Length = 1098 Score = 51.6 bits (122), Expect = 6e-06 Identities = 22/56 (39%), Positives = 30/56 (53%) Frame = +2 Query: 26 LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLLHCIRDC 193 L WL H++VPTL++LHH I + +C C +ET LHC+RDC Sbjct: 796 LFWLACHEAVPTLAMLHHRNIASSPIC------------PRCSNHNETFLHCVRDC 839 >GAU20604.1 hypothetical protein TSUD_33400 [Trifolium subterraneum] Length = 1174 Score = 51.6 bits (122), Expect = 6e-06 Identities = 24/56 (42%), Positives = 30/56 (53%) Frame = +2 Query: 26 LIWLVLHDSVPTLSVLHHSGITPTAVCKIPTLSVLHHSGKICQREDETLLHCIRDC 193 L WL HD+VPTLS+LHH I +C C ++ ET LHC+RDC Sbjct: 871 LFWLSCHDAVPTLSMLHHRNIASCPIC------------TRCGQQIETFLHCVRDC 914