BLASTX nr result
ID: Glycyrrhiza34_contig00021467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00021467 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU40259.1 hypothetical protein TSUD_60490 [Trifolium subterraneum] 55 4e-07 XP_013456657.1 O-acyltransferase WSD1-like protein [Medicago tru... 54 3e-06 XP_003607473.2 O-acyltransferase WSD1-like protein [Medicago tru... 54 3e-06 >GAU40259.1 hypothetical protein TSUD_60490 [Trifolium subterraneum] Length = 175 Score = 55.5 bits (132), Expect = 4e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 340 TLKGFIDELKLKFCMEKAVEDISKAATDISEIP 242 TLKGFIDE K KFCMEKA+E I KAA DISEIP Sbjct: 140 TLKGFIDEQKFKFCMEKAIEVIFKAAMDISEIP 172 >XP_013456657.1 O-acyltransferase WSD1-like protein [Medicago truncatula] KEH30688.1 O-acyltransferase WSD1-like protein [Medicago truncatula] Length = 401 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 340 TLKGFIDELKLKFCMEKAVEDISKAATDISEIP 242 TLKGFIDE K KFCMEKAVE I KAA +ISEIP Sbjct: 366 TLKGFIDERKFKFCMEKAVEVIFKAAMEISEIP 398 >XP_003607473.2 O-acyltransferase WSD1-like protein [Medicago truncatula] AES89670.2 O-acyltransferase WSD1-like protein [Medicago truncatula] Length = 470 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 340 TLKGFIDELKLKFCMEKAVEDISKAATDISEIP 242 TLKGFIDE K KFCMEKAVE I KAA +ISEIP Sbjct: 435 TLKGFIDERKFKFCMEKAVEVIFKAAMEISEIP 467