BLASTX nr result
ID: Glycyrrhiza34_contig00021280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00021280 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO99518.1 hypothetical protein CCACVL1_03761 [Corchorus capsula... 67 5e-12 ABN08797.1 hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago... 65 2e-11 OMP12261.1 ORF45 protein [Corchorus olitorius] 64 7e-11 NP_054986.1 ORF45 protein (plastid) [Spinacia oleracea] CAB88782... 63 1e-10 OMP08513.1 ORF45 protein [Corchorus olitorius] 62 3e-10 AAA84691.1 unknown (chloroplast) [Nicotiana tabacum] 55 2e-07 OMP07415.1 hypothetical protein CCACVL1_01308 [Corchorus capsula... 52 1e-06 XP_003621691.1 proton-translocating NADH-quinone oxidoreductase,... 55 6e-06 >OMO99518.1 hypothetical protein CCACVL1_03761 [Corchorus capsularis] OMP12483.1 ORF45 protein [Corchorus olitorius] OMP13163.1 ORF45 protein [Corchorus olitorius] OMP13398.1 ORF45 protein [Corchorus olitorius] OMP13977.1 ORF45 protein [Corchorus olitorius] OMP14055.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 66.6 bits (161), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 226 GYYDFE*AAMVKLVDTLLLGSSARASRFESEWRHDI 333 GYYDF+ AAMVK VDTLLLGSSARASRFESEWRH+I Sbjct: 2 GYYDFKQAAMVKSVDTLLLGSSARASRFESEWRHNI 37 >ABN08797.1 hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago truncatula] Length = 40 Score = 65.1 bits (157), Expect = 2e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 338 DGMSCRHSDSNRDALALLPKSSVSTNFTIAAYSKS 234 D M CR+SDSNRDALALLPKSSVSTNFTIAAYSKS Sbjct: 6 DRMPCRYSDSNRDALALLPKSSVSTNFTIAAYSKS 40 >OMP12261.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 63.5 bits (153), Expect = 7e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 226 GYYDFE*AAMVKLVDTLLLGSSARASRFESEWRHDI 333 GYYDF+ AAMVK V TLLLGSSARASRFESEWRH+I Sbjct: 2 GYYDFKQAAMVKSVATLLLGSSARASRFESEWRHNI 37 >NP_054986.1 ORF45 protein (plastid) [Spinacia oleracea] CAB88782.1 ORF45 protein (chloroplast) [Spinacia oleracea] Length = 45 Score = 63.2 bits (152), Expect = 1e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +1 Query: 226 GYYDFE*AAMVKLVDTLLLGSSARASRFESEWRHDIPSYILK 351 GYYDF+ AAMVKLVDTLLLGSSARASRFESE RH I + K Sbjct: 2 GYYDFKEAAMVKLVDTLLLGSSARASRFESESRHGILQILKK 43 >OMP08513.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 62.0 bits (149), Expect = 3e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 226 GYYDFE*AAMVKLVDTLLLGSSARASRFESEWRHDI 333 GYYDF+ AAMVK V+TLLLG++ARASRFESEWRH+I Sbjct: 2 GYYDFKQAAMVKPVNTLLLGNNARASRFESEWRHNI 37 >AAA84691.1 unknown (chloroplast) [Nicotiana tabacum] Length = 35 Score = 54.7 bits (130), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 247 AAMVKLVDTLLLGSSARASRFESEWRHDI 333 AAMVKLVDTLLLGSSA ASRFESEWRH + Sbjct: 6 AAMVKLVDTLLLGSSANASRFESEWRHTV 34 >OMP07415.1 hypothetical protein CCACVL1_01308 [Corchorus capsularis] Length = 28 Score = 52.4 bits (124), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 253 MVKLVDTLLLGSSARASRFESEWRHDI 333 MVK VDTLLLGSSARASRFESEWRH+I Sbjct: 1 MVKSVDTLLLGSSARASRFESEWRHNI 27 >XP_003621691.1 proton-translocating NADH-quinone oxidoreductase, protein [Medicago truncatula] AES77909.1 proton-translocating NADH-quinone oxidoreductase, protein [Medicago truncatula] Length = 811 Score = 55.5 bits (132), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 332 MSCRHSDSNRDALALLPKSSVSTNFTIAAYSKS 234 M CR+SDSNRDALALLPKSSVSTNFTIA + S Sbjct: 1 MPCRYSDSNRDALALLPKSSVSTNFTIAKQNSS 33