BLASTX nr result
ID: Glycyrrhiza34_contig00020804
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00020804 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013452951.1 hypothetical protein MTR_6g082710, partial [Medic... 53 1e-06 >XP_013452951.1 hypothetical protein MTR_6g082710, partial [Medicago truncatula] KEH26979.1 hypothetical protein MTR_6g082710, partial [Medicago truncatula] Length = 108 Score = 53.1 bits (126), Expect = 1e-06 Identities = 27/48 (56%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 2 FTLFCFTRFFQLRRQSLVTA-TDLSYFLKNTCLKATLLFILIEPHCKI 142 F +FCFTRFF R +SL+ A TDL YF + L TLLFIL+ PH K+ Sbjct: 42 FKIFCFTRFFHYRERSLLVAITDLQYFGRMLGLIVTLLFILVNPHKKL 89