BLASTX nr result
ID: Glycyrrhiza34_contig00020565
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00020565 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014499029.1 PREDICTED: endoribonuclease Dicer homolog 1 [Vign... 59 5e-08 XP_006604922.1 PREDICTED: endoribonuclease Dicer homolog 1-like ... 57 1e-07 KHN11363.1 Endoribonuclease Dicer like 1 [Glycine soja] 57 1e-07 BAT80376.1 hypothetical protein VIGAN_02338200 [Vigna angularis ... 56 3e-07 XP_017409805.1 PREDICTED: endoribonuclease Dicer homolog 1 [Vign... 56 3e-07 KYP72012.1 Endoribonuclease Dicer isogeny [Cajanus cajan] 54 2e-06 XP_019432886.1 PREDICTED: endoribonuclease Dicer homolog 1 isofo... 53 6e-06 XP_019432885.1 PREDICTED: endoribonuclease Dicer homolog 1 isofo... 53 6e-06 >XP_014499029.1 PREDICTED: endoribonuclease Dicer homolog 1 [Vigna radiata var. radiata] Length = 1957 Score = 58.5 bits (140), Expect = 5e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = -1 Query: 275 VSYSQE----SRGRDVNADGEERCGKRARLGSYKNERPSHGRLNYQAK 144 V+YS+E + G DV DGEERC KRARLG YKNERP +GR NYQ K Sbjct: 138 VNYSKERGVLNGGHDV--DGEERCSKRARLGGYKNERPHYGRGNYQGK 183 >XP_006604922.1 PREDICTED: endoribonuclease Dicer homolog 1-like [Glycine max] KRG97264.1 hypothetical protein GLYMA_19G261200 [Glycine max] KRG97265.1 hypothetical protein GLYMA_19G261200 [Glycine max] KRG97266.1 hypothetical protein GLYMA_19G261200 [Glycine max] KRG97267.1 hypothetical protein GLYMA_19G261200 [Glycine max] Length = 1945 Score = 57.4 bits (137), Expect = 1e-07 Identities = 29/48 (60%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = -1 Query: 275 VSYSQESRGRDVNA----DGEERCGKRARLGSYKNERPSHGRLNYQAK 144 V YSQE +N DGEERC KRARLG Y N+RP HGR NYQ K Sbjct: 127 VDYSQERGTPTLNGGLDFDGEERCSKRARLGGYNNDRPYHGRGNYQGK 174 >KHN11363.1 Endoribonuclease Dicer like 1 [Glycine soja] Length = 1946 Score = 57.4 bits (137), Expect = 1e-07 Identities = 29/48 (60%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = -1 Query: 275 VSYSQESRGRDVNA----DGEERCGKRARLGSYKNERPSHGRLNYQAK 144 V YSQE +N DGEERC KRARLG Y N+RP HGR NYQ K Sbjct: 127 VDYSQERGTPTLNGGLDFDGEERCSKRARLGGYNNDRPYHGRGNYQGK 174 >BAT80376.1 hypothetical protein VIGAN_02338200 [Vigna angularis var. angularis] Length = 1957 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = -1 Query: 275 VSYSQE----SRGRDVNADGEERCGKRARLGSYKNERPSHGRLNYQAK 144 V+YS+E + G DV D EERC KRARLG YKNERP +GR NYQ K Sbjct: 138 VNYSKERGVLNGGHDV--DSEERCSKRARLGGYKNERPHYGRGNYQGK 183 >XP_017409805.1 PREDICTED: endoribonuclease Dicer homolog 1 [Vigna angularis] KOM29117.1 hypothetical protein LR48_Vigan635s004200 [Vigna angularis] Length = 1957 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = -1 Query: 275 VSYSQE----SRGRDVNADGEERCGKRARLGSYKNERPSHGRLNYQAK 144 V+YS+E + G DV D EERC KRARLG YKNERP +GR NYQ K Sbjct: 138 VNYSKERGVLNGGHDV--DSEERCSKRARLGGYKNERPHYGRGNYQGK 183 >KYP72012.1 Endoribonuclease Dicer isogeny [Cajanus cajan] Length = 1913 Score = 53.9 bits (128), Expect = 2e-06 Identities = 28/37 (75%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -1 Query: 251 GRDVNADGEERCGKRARLGSYKNERPSHGR-LNYQAK 144 G DV DGEERCGKRARLG YKNERP +GR NYQ K Sbjct: 100 GHDV--DGEERCGKRARLGGYKNERPYYGRGNNYQGK 134 >XP_019432886.1 PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Lupinus angustifolius] OIW21387.1 hypothetical protein TanjilG_02532 [Lupinus angustifolius] Length = 1986 Score = 52.8 bits (125), Expect = 6e-06 Identities = 29/53 (54%), Positives = 33/53 (62%), Gaps = 9/53 (16%) Frame = -1 Query: 275 VSYSQESRGRDVNAD---------GEERCGKRARLGSYKNERPSHGRLNYQAK 144 V YS+E RG + D GEER KRARLG+YKNER GR+NYQAK Sbjct: 161 VGYSEEGRGLNRGRDLVKEHDVEGGEERYSKRARLGNYKNERHYSGRVNYQAK 213 >XP_019432885.1 PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Lupinus angustifolius] Length = 1987 Score = 52.8 bits (125), Expect = 6e-06 Identities = 29/53 (54%), Positives = 33/53 (62%), Gaps = 9/53 (16%) Frame = -1 Query: 275 VSYSQESRGRDVNAD---------GEERCGKRARLGSYKNERPSHGRLNYQAK 144 V YS+E RG + D GEER KRARLG+YKNER GR+NYQAK Sbjct: 161 VGYSEEGRGLNRGRDLVKEHDVEGGEERYSKRARLGNYKNERHYSGRVNYQAK 213