BLASTX nr result
ID: Glycyrrhiza34_contig00019043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00019043 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487490.1 PREDICTED: rho GTPase-activating protein 5 [Cicer... 69 1e-11 XP_003596831.1 PAK-box/P21-Rho-binding domain Rho GTPase activat... 55 7e-07 >XP_004487490.1 PREDICTED: rho GTPase-activating protein 5 [Cicer arietinum] Length = 450 Score = 68.9 bits (167), Expect = 1e-11 Identities = 43/99 (43%), Positives = 49/99 (49%), Gaps = 4/99 (4%) Frame = +3 Query: 6 EFPPKGFVSEKSVLECSAESLQNNXXXXXXXXXXXXXXENPVCKGDLYCEYPPXXXXXXX 185 E + FVSEK VLECS ESLQNN ENPVC DLYCE+PP Sbjct: 339 EAQEENFVSEKPVLECSTESLQNNSSTGGESGSLISTSENPVCNEDLYCEFPPKRNMGKN 398 Query: 186 XXXXXXXXXXXXXPKK---KQHVIH-TMPVEKKGTRTMS 290 KK +QHVI+ + VEKKG RT+S Sbjct: 399 KSGQSSSSNARKGSKKTRGQQHVINEKVLVEKKGMRTLS 437 >XP_003596831.1 PAK-box/P21-Rho-binding domain Rho GTPase activating protein [Medicago truncatula] AES67082.1 PAK-box/P21-Rho-binding domain Rho GTPase activating protein [Medicago truncatula] Length = 451 Score = 55.5 bits (132), Expect = 7e-07 Identities = 35/94 (37%), Positives = 44/94 (46%), Gaps = 5/94 (5%) Frame = +3 Query: 24 FVSEKSVLECSAESLQNNXXXXXXXXXXXXXXENPVCKGDLYCEYPPXXXXXXXXXXXXX 203 FVSEK+V+EC+ ESL+ N ENP+C +LYCE+PP Sbjct: 345 FVSEKTVVECTPESLEKNSSTERESGSLIRTSENPICNEELYCEFPPKKNMGKNNKSGQS 404 Query: 204 XXXXXXXPKKK----QHVIHTM-PVEKKGTRTMS 290 KK Q VI+ VEKKG RT+S Sbjct: 405 SSSNARKGSKKTRGQQPVINGKGSVEKKGMRTLS 438