BLASTX nr result
ID: Glycyrrhiza34_contig00018954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018954 (510 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004510634.1 PREDICTED: uncharacterized protein LOC101511087 [... 66 2e-09 XP_003627534.2 P-loop nucleoside triphosphate hydrolase superfam... 65 4e-09 >XP_004510634.1 PREDICTED: uncharacterized protein LOC101511087 [Cicer arietinum] Length = 483 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 78 LCGGDGFSAVKDLRKLYGLFRLRNVKRNGSSNVLVN 185 LCG DGFS VKD+RKLYGLFRLRNVKRN SSN+LVN Sbjct: 445 LCGVDGFSTVKDIRKLYGLFRLRNVKRNRSSNLLVN 480 >XP_003627534.2 P-loop nucleoside triphosphate hydrolase superfamily protein, putative [Medicago truncatula] AET02010.2 P-loop nucleoside triphosphate hydrolase superfamily protein, putative [Medicago truncatula] Length = 457 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 78 LCGGDGFSAVKDLRKLYGLFRLRNVKRNGSSNVLVNE 188 LCGGDGFS VKDL+K+YGL RLRNVKRN S N+LVN+ Sbjct: 418 LCGGDGFSTVKDLKKIYGLLRLRNVKRNMSGNLLVND 454