BLASTX nr result
ID: Glycyrrhiza34_contig00018829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018829 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU11557.1 hypothetical protein TSUD_345480 [Trifolium subterran... 101 7e-24 ABN09013.1 Fibronectin, type III-like fold [Medicago truncatula] 101 7e-24 XP_016650977.1 PREDICTED: piezo-type mechanosensitive ion channe... 96 1e-23 KYP71265.1 Protein FAM38B [Cajanus cajan] 99 4e-23 BAT88037.1 hypothetical protein VIGAN_05147000 [Vigna angularis ... 101 6e-23 XP_012569621.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_007147084.1 hypothetical protein PHAVU_006G095000g [Phaseolus... 101 6e-23 KHN43258.1 Piezo-type mechanosensitive ion channel component 2 [... 101 6e-23 KRG96876.1 hypothetical protein GLYMA_19G238300 [Glycine max] 101 6e-23 XP_017436241.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 KRG96875.1 hypothetical protein GLYMA_19G238300 [Glycine max] 101 6e-23 XP_007147083.1 hypothetical protein PHAVU_006G095000g [Phaseolus... 101 6e-23 XP_017436239.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_012569619.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_012569618.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_012569617.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_012569616.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_014627564.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 XP_003626328.2 DUF3595 family protein [Medicago truncatula] AES8... 101 6e-23 XP_017436236.1 PREDICTED: piezo-type mechanosensitive ion channe... 101 6e-23 >GAU11557.1 hypothetical protein TSUD_345480 [Trifolium subterraneum] Length = 308 Score = 101 bits (251), Expect = 7e-24 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 227 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 273 >ABN09013.1 Fibronectin, type III-like fold [Medicago truncatula] Length = 308 Score = 101 bits (251), Expect = 7e-24 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 227 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 273 >XP_016650977.1 PREDICTED: piezo-type mechanosensitive ion channel homolog [Prunus mume] Length = 111 Score = 95.5 bits (236), Expect = 1e-23 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIP ENLPSCDR +AICEDIY Sbjct: 30 SIWGLYITFVLAVGRFIRLQCSDLRMRIPHENLPSCDRFIAICEDIY 76 >KYP71265.1 Protein FAM38B [Cajanus cajan] Length = 308 Score = 99.4 bits (246), Expect = 4e-23 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLP CDRLMAICEDIY Sbjct: 227 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPHCDRLMAICEDIY 273 >BAT88037.1 hypothetical protein VIGAN_05147000 [Vigna angularis var. angularis] Length = 1329 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 1248 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 1294 >XP_012569621.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X6 [Cicer arietinum] Length = 1967 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 1886 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 1932 >XP_007147084.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] ESW19078.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] Length = 2008 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 1927 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 1973 >KHN43258.1 Piezo-type mechanosensitive ion channel component 2 [Glycine soja] Length = 2023 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 1942 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 1988 >KRG96876.1 hypothetical protein GLYMA_19G238300 [Glycine max] Length = 2085 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2004 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2050 >XP_017436241.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X5 [Vigna angularis] Length = 2099 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2018 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2064 >KRG96875.1 hypothetical protein GLYMA_19G238300 [Glycine max] Length = 2138 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2057 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2103 >XP_007147083.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] XP_007147085.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] ESW19077.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] ESW19079.1 hypothetical protein PHAVU_006G095000g [Phaseolus vulgaris] Length = 2193 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2112 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2158 >XP_017436239.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X3 [Vigna angularis] Length = 2220 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2139 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2185 >XP_012569619.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X4 [Cicer arietinum] Length = 2340 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2259 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2305 >XP_012569618.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X3 [Cicer arietinum] Length = 2345 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2264 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2310 >XP_012569617.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X2 [Cicer arietinum] Length = 2405 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2324 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2370 >XP_012569616.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X1 [Cicer arietinum] Length = 2451 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2370 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2416 >XP_014627564.1 PREDICTED: piezo-type mechanosensitive ion channel homolog [Glycine max] Length = 2462 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2381 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2427 >XP_003626328.2 DUF3595 family protein [Medicago truncatula] AES82546.2 DUF3595 family protein [Medicago truncatula] Length = 2462 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2381 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2427 >XP_017436236.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X1 [Vigna angularis] XP_017436237.1 PREDICTED: piezo-type mechanosensitive ion channel homolog isoform X1 [Vigna angularis] Length = 2465 Score = 101 bits (251), Expect = 6e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 285 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 145 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY Sbjct: 2384 SIWGLYITFVLAVGRFIRLQCSDLRMRIPFENLPSCDRLMAICEDIY 2430