BLASTX nr result
ID: Glycyrrhiza34_contig00018454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018454 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBS91011.1 conserved protein of unknown function (plasmid) [Azos... 112 2e-30 JAN94726.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [D... 106 1e-27 BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BA... 107 3e-27 BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BA... 107 4e-27 CWM94285.1 Cell wall-associated hydrolase [Neisseria meningitidi... 105 1e-26 CWP67249.1 Cell wall-associated hydrolase [Neisseria meningitidi... 105 2e-26 JAN94732.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [D... 106 2e-26 JAN94728.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [D... 106 2e-26 JAN94736.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [D... 106 2e-26 BAG46932.1 cell wall-associated hydrolase [Burkholderia multivor... 104 3e-26 CWO70233.1 Cell wall-associated hydrolase [Neisseria meningitidi... 103 4e-26 KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholder... 104 5e-26 CWS15795.1 Cell wall-associated hydrolase [Neisseria meningitidis] 102 1e-25 CWT82569.1 Cell wall-associated hydrolase [Neisseria meningitidi... 102 1e-25 CKL43271.1 Cell wall-associated hydrolase [Neisseria meningitidi... 102 2e-25 ELL01666.1 hypothetical protein NM4119_1450, partial [Neisseria ... 100 4e-25 CWO51373.1 Cell wall-associated hydrolase [Neisseria meningitidis] 100 1e-24 EJU56892.1 cell wall-associated hydrolase [Neisseria meningitidi... 100 1e-24 CWO79403.1 Cell wall-associated hydrolase [Neisseria meningitidi... 100 2e-24 CWP48701.1 Cell wall-associated hydrolase [Neisseria meningitidi... 100 2e-24 >CBS91011.1 conserved protein of unknown function (plasmid) [Azospirillum lipoferum 4B] Length = 113 Score = 112 bits (279), Expect = 2e-30 Identities = 55/70 (78%), Positives = 58/70 (82%) Frame = -3 Query: 221 DRFPTGLSLPSRASVTLWEATAPVKLPAMRCPGPRSGAAVRQPYLQGWYFKDGSTQAGAH 42 +RFPT LS PSRASVTLWEATAPVKLPAM+ PGP S A VR LQGWYFK GST+AGA Sbjct: 35 ERFPTALSPPSRASVTLWEATAPVKLPAMQGPGPGSRATVRCQRLQGWYFKVGSTRAGAQ 94 Query: 41 ASKPTTYPTH 12 ASKP TYPTH Sbjct: 95 ASKPPTYPTH 104 >JAN94726.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [Daphnia magna] Length = 167 Score = 106 bits (265), Expect = 1e-27 Identities = 49/68 (72%), Positives = 53/68 (77%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 D RP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ ++GGIS AP LA +L Sbjct: 36 DVRPYLAYLRTPPLRFGRRPPQSNCLPCTVPDPDNGPRLEPQTHQGGISTSAPQDLATLL 95 Query: 37 QSLPPILH 14 QSLPPILH Sbjct: 96 QSLPPILH 103 >BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BAO87487.1 putative membrane protein [Burkholderia sp. RPE67] BAO87598.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 107 bits (267), Expect = 3e-27 Identities = 50/68 (73%), Positives = 52/68 (76%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 DFRP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ +GGISR AP RLA Sbjct: 148 DFRPYLAYLRTPPLRFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWF 207 Query: 37 QSLPPILH 14 SLPPILH Sbjct: 208 HSLPPILH 215 >BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BAO88159.1 putative membrane protein [Burkholderia sp. RPE67] BAO90886.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 107 bits (266), Expect = 4e-27 Identities = 50/68 (73%), Positives = 52/68 (76%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 DFRP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ +GGISR AP RLA Sbjct: 148 DFRPYLAYLRTPPLHFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWF 207 Query: 37 QSLPPILH 14 SLPPILH Sbjct: 208 HSLPPILH 215 >CWM94285.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ55632.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP70409.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT55260.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ46117.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ13555.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ36002.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM24872.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM89367.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM29376.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM58488.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ43465.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO88989.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM95535.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR30100.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ33640.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ59206.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM36524.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS69311.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM22624.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP71542.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM59150.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP51019.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM08047.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO07120.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT61805.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM47351.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT94404.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR12276.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN35808.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR65428.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS39952.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM58445.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ35548.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR63221.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ50134.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO61260.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP84864.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR81609.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO15838.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM62696.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ53410.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ41081.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ35446.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR13064.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR93195.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR58618.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN75830.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN92984.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN28987.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN69271.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM82912.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR53819.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP88866.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM23382.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM26625.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ19861.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT62879.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM53098.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT53692.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM83365.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO21529.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN92282.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS58259.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ37187.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS05620.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS03273.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR66185.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ77951.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM54395.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR31800.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS23086.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO96526.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS82264.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ60516.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO11803.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO26530.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP00554.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS13977.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ30750.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM62238.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN86557.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN54402.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ65336.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 105 bits (261), Expect = 1e-26 Identities = 49/69 (71%), Positives = 54/69 (78%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G RL+ ++GGISR AP RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASL 192 Query: 40 LQSLPPILH 14 LQSLPPILH Sbjct: 193 LQSLPPILH 201 >CWP67249.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT59615.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS18382.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR45378.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ16501.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN87478.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM92680.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN67326.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP45878.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP38468.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ30366.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO45593.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT45368.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM35122.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ61517.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR11989.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT68492.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP89907.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM28216.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ55809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM90768.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ97896.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS39350.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO06049.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN51672.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM72155.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO27120.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN29951.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ78977.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ62225.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS89623.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM32710.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 105 bits (261), Expect = 2e-26 Identities = 49/69 (71%), Positives = 54/69 (78%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G RL+ ++GGISR AP RLA + Sbjct: 147 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASL 206 Query: 40 LQSLPPILH 14 LQSLPPILH Sbjct: 207 LQSLPPILH 215 >JAN94732.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [Daphnia magna] Length = 288 Score = 106 bits (265), Expect = 2e-26 Identities = 49/68 (72%), Positives = 53/68 (77%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 D RP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ ++GGIS AP LA +L Sbjct: 68 DVRPYLAYLRTPPLRFGRRPPQSNCLPCTVPDPDNGPRLEPQTHQGGISTSAPQDLATLL 127 Query: 37 QSLPPILH 14 QSLPPILH Sbjct: 128 QSLPPILH 135 >JAN94728.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [Daphnia magna] Length = 305 Score = 106 bits (265), Expect = 2e-26 Identities = 49/68 (72%), Positives = 53/68 (77%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 D RP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ ++GGIS AP LA +L Sbjct: 68 DVRPYLAYLRTPPLRFGRRPPQSNCLPCTVPDPDNGPRLEPQTHQGGISTSAPQDLATLL 127 Query: 37 QSLPPILH 14 QSLPPILH Sbjct: 128 QSLPPILH 135 >JAN94736.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [Daphnia magna] Length = 306 Score = 106 bits (265), Expect = 2e-26 Identities = 49/68 (72%), Positives = 53/68 (77%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 D RP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ ++GGIS AP LA +L Sbjct: 68 DVRPYLAYLRTPPLRFGRRPPQSNCLPCTVPDPDNGPRLEPQTHQGGISTSAPQDLATLL 127 Query: 37 QSLPPILH 14 QSLPPILH Sbjct: 128 QSLPPILH 135 >BAG46932.1 cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 104 bits (260), Expect = 3e-26 Identities = 49/68 (72%), Positives = 52/68 (76%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 DFRP AYLR PPL FGRRPPQSNCLPC VPDPD GPRL+ +GGISR AP +LA Sbjct: 148 DFRPYLAYLRTPPLPFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPKLAFRF 207 Query: 37 QSLPPILH 14 SLPPILH Sbjct: 208 HSLPPILH 215 >CWO70233.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS61864.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 103 bits (257), Expect = 4e-26 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G RL+ ++GGISR P RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTTPQRLASL 192 Query: 40 LQSLPPILH 14 LQSLPPILH Sbjct: 193 LQSLPPILH 201 >KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 104 bits (259), Expect = 5e-26 Identities = 49/68 (72%), Positives = 51/68 (75%) Frame = -1 Query: 217 DFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPML 38 DFRP AYL PPL FGRRPPQSNCLPC VPDPD GPRL+ +GGISR AP RLA Sbjct: 148 DFRPYLAYLCTPPLRFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWF 207 Query: 37 QSLPPILH 14 SLPPILH Sbjct: 208 HSLPPILH 215 >CWS15795.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 102 bits (254), Expect = 1e-25 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G RL+ ++GGISR AP RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASL 192 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 193 LLSLPPILH 201 >CWT82569.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP44468.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT59196.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS83033.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP46906.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP27798.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN98251.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ04956.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT93866.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP96790.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT92957.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR69071.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN70881.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN17584.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ42038.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP73355.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO79925.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR78282.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS37293.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO16958.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 102 bits (254), Expect = 1e-25 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 192 Query: 40 LQSLPPILH 14 LQSLPPILH Sbjct: 193 LQSLPPILH 201 >CKL43271.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR65376.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO43812.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS31701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR93279.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT88142.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP62169.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO09337.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS97823.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 102 bits (254), Expect = 2e-25 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 147 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 206 Query: 40 LQSLPPILH 14 LQSLPPILH Sbjct: 207 LQSLPPILH 215 >ELL01666.1 hypothetical protein NM4119_1450, partial [Neisseria meningitidis 4119] Length = 156 Score = 99.8 bits (247), Expect = 4e-25 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 87 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 146 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 147 LLSLPPILH 155 >CWO51373.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 99.8 bits (247), Expect = 1e-24 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 192 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 193 LLSLPPILH 201 >EJU56892.1 cell wall-associated hydrolase [Neisseria meningitidis NM140] EJU61973.1 cell wall-associated hydrolase [Neisseria meningitidis NM140] EJU62544.1 cell wall-associated hydrolase [Neisseria meningitidis 69166] ELK74541.1 hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] ELL00985.1 hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] CWO33360.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS22460.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT52492.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO87056.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP11771.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR97728.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN57532.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP67952.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM35585.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN41524.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWU00589.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ40111.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT04099.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP26351.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT63701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS70177.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO22916.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP54997.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS22406.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR45207.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP53785.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP03678.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT87473.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP91498.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN67092.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO96602.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO95311.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT55895.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT13818.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP48902.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS33681.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP78000.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO12897.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS86296.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP20575.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT29169.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP63785.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS84972.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP92574.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP59033.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT49266.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS27719.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM46796.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN46619.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ68119.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO15682.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ08477.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS17962.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP30862.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO42413.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR29661.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO31337.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ04898.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP10150.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM05078.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM12681.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT61744.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN57772.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR90150.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT16329.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR30726.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT07011.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP52443.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN21252.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN45814.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN19844.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ43419.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR10684.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR33680.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO48013.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT37813.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP53477.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP86780.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT58035.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN17637.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN08518.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS23659.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR26094.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT34423.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP99181.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS36926.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM80848.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN88221.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ99732.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO40610.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO11922.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR49944.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR50940.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ80168.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP28080.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS36757.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN29027.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO57148.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS94689.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO86275.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS34667.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN65467.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ62273.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR08251.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT18242.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP36630.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT70851.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ29131.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM14786.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ17869.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP41619.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT32077.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 99.8 bits (247), Expect = 1e-24 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 133 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 192 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 193 LLSLPPILH 201 >CWO79403.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS73015.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP48004.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT53749.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP56073.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT45211.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP40556.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS34214.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 99.8 bits (247), Expect = 2e-24 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 147 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 206 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 207 LLSLPPILH 215 >CWP48701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR29009.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR82218.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR46809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS91548.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN30464.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN27922.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS66742.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR06838.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR48486.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR10327.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN24095.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO60614.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN25947.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS98001.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS59497.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN72848.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP39092.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ32365.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR13329.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR32013.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO15311.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO60288.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO73300.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO97724.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM32626.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR46169.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR60621.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS55187.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO74333.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS49369.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN33205.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT97847.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO92715.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT28786.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS90747.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM57104.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS63743.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO03883.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS61697.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO81400.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT19600.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS68250.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO24807.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT09763.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR74708.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP19917.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP84832.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP03601.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS70498.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN63518.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS36222.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR66421.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO88263.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO98192.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS47444.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT98357.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS64753.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS46428.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS76708.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO66988.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM84030.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR78250.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS34318.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT95575.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM57972.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ57771.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ39864.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO66358.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM94174.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP76809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO82057.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO41141.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO43448.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR92606.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO68101.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP03041.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR09158.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ50251.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR40772.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO02003.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN69442.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM99199.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS97164.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO86758.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS41307.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT95437.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM63050.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP38428.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM29569.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR37263.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR81410.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT48259.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM97468.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN50119.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM76951.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN34996.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR65665.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP39424.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ41661.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN92488.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ79228.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM13605.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT09979.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT10765.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN20861.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT20193.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP85087.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ46953.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO47217.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR53907.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN72701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT19570.1 Cell wall-associated hydrolase [Neisseria meningitidis] ANW90621.1 hypothetical protein DE8555_0048 [Neisseria meningitidis] ANW92138.1 hypothetical protein DE8555_1596 [Neisseria meningitidis] ANW92423.1 hypothetical protein DE8555_1889 [Neisseria meningitidis] ANW92538.1 hypothetical protein DE8555_2009 [Neisseria meningitidis] Length = 216 Score = 99.8 bits (247), Expect = 2e-24 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 220 TDFRPV*AYLRAPPLLFGRRPPQSNCLPCAVPDPDQGPRLDNHIYKGGISRMAPHRLAPM 41 +DFRP LR PPL FGRRPPQSNCLPC VPDPD G L+ ++GGISR AP RLA + Sbjct: 147 SDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASL 206 Query: 40 LQSLPPILH 14 L SLPPILH Sbjct: 207 LLSLPPILH 215