BLASTX nr result
ID: Glycyrrhiza34_contig00018259
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018259 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007132650.1 hypothetical protein PHAVU_011G113100g [Phaseolus... 60 6e-10 KHN31947.1 hypothetical protein glysoja_025781 [Glycine soja] KH... 57 9e-09 OIW12083.1 hypothetical protein TanjilG_15323 [Lupinus angustifo... 52 6e-07 KRH22424.1 hypothetical protein GLYMA_13G299500 [Glycine max] KR... 52 6e-07 XP_003605726.1 transmembrane protein, putative [Medicago truncat... 52 6e-07 ACU15485.1 unknown [Glycine max] KHN04273.1 hypothetical protein... 51 2e-06 XP_007149877.1 hypothetical protein PHAVU_005G106300g [Phaseolus... 50 5e-06 OIW18415.1 hypothetical protein TanjilG_10279 [Lupinus angustifo... 53 9e-06 OIW13365.1 hypothetical protein TanjilG_16474 [Lupinus angustifo... 49 1e-05 >XP_007132650.1 hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] ESW04644.1 hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] Length = 51 Score = 59.7 bits (143), Expect = 6e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAKLEEMD SVAK KKKRNHGS RFFVFVDY Sbjct: 1 MAKLEEMDNSVAKIKKKRNHGSTRFFVFVDY 31 >KHN31947.1 hypothetical protein glysoja_025781 [Glycine soja] KHN41143.1 hypothetical protein glysoja_017187 [Glycine soja] KRH56016.1 hypothetical protein GLYMA_06G296400 [Glycine max] Length = 51 Score = 56.6 bits (135), Expect = 9e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAKLEE+D SV+KTKKKRNHGS FFVFVDY Sbjct: 1 MAKLEEIDNSVSKTKKKRNHGSTGFFVFVDY 31 >OIW12083.1 hypothetical protein TanjilG_15323 [Lupinus angustifolius] Length = 51 Score = 52.0 bits (123), Expect = 6e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAK+EE+DES AK + K NHGS+RFFVFVDY Sbjct: 1 MAKIEELDESSAKRRPKMNHGSSRFFVFVDY 31 >KRH22424.1 hypothetical protein GLYMA_13G299500 [Glycine max] KRH22425.1 hypothetical protein GLYMA_13G299500 [Glycine max] Length = 51 Score = 52.0 bits (123), Expect = 6e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAK+EE++ES+ K+K KRNHGS FFVFVDY Sbjct: 1 MAKIEELNESIPKSKNKRNHGSTTFFVFVDY 31 >XP_003605726.1 transmembrane protein, putative [Medicago truncatula] AES87923.1 transmembrane protein, putative [Medicago truncatula] Length = 52 Score = 52.0 bits (123), Expect = 6e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 318 LMAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 + AKL+EMDESVA++KKKRNHGS R FVF+ Y Sbjct: 1 MAAKLKEMDESVAESKKKRNHGSTRLFVFIAY 32 >ACU15485.1 unknown [Glycine max] KHN04273.1 hypothetical protein glysoja_037953 [Glycine soja] Length = 51 Score = 50.8 bits (120), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAK+EE+++SVAK+K KRNHGS FFV VDY Sbjct: 1 MAKIEELNDSVAKSKNKRNHGSTMFFVIVDY 31 >XP_007149877.1 hypothetical protein PHAVU_005G106300g [Phaseolus vulgaris] ESW21871.1 hypothetical protein PHAVU_005G106300g [Phaseolus vulgaris] Length = 51 Score = 49.7 bits (117), Expect = 5e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVD 226 MA ++E++ESVAK+K KRNHGS RFF+FVD Sbjct: 1 MANIKELNESVAKSKTKRNHGSTRFFIFVD 30 >OIW18415.1 hypothetical protein TanjilG_10279 [Lupinus angustifolius] Length = 391 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAK+EE DES+AK + KRNH S RFFVFVDY Sbjct: 341 MAKIEEFDESIAKMRPKRNHNSTRFFVFVDY 371 >OIW13365.1 hypothetical protein TanjilG_16474 [Lupinus angustifolius] Length = 51 Score = 48.9 bits (115), Expect = 1e-05 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 315 MAKLEEMDESVAKTKKKRNHGSARFFVFVDY 223 MAK+EE+DES AK + K+NH +RFFVFVDY Sbjct: 1 MAKIEELDESAAKLRPKKNHQPSRFFVFVDY 31