BLASTX nr result
ID: Glycyrrhiza34_contig00018166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018166 (725 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016200482.1 PREDICTED: photosystem I P700 chlorophyll a apopr... 58 4e-06 >XP_016200482.1 PREDICTED: photosystem I P700 chlorophyll a apoprotein A1-like [Arachis ipaensis] Length = 529 Score = 57.8 bits (138), Expect = 4e-06 Identities = 37/102 (36%), Positives = 45/102 (44%), Gaps = 30/102 (29%) Frame = -2 Query: 631 RFPARFALTAEALAVREAFSLATNCMTGRVVVESDCQHLVHA------------------ 506 RF A+TAEA A REA L N G ++E+DC LV A Sbjct: 385 RFTTILAITAEAQAYREALILIKNLQIGNCIIETDCLPLVQAIKAITPIADADAIIRDIL 444 Query: 505 ------------WTPREGNHVAHQLASLESRNILPLYWVRFP 416 WTPR+GN VAHQLA+L + N L W+ P Sbjct: 445 QLLDEAPDVGATWTPRKGNKVAHQLAALAAGNELRRQWIFDP 486