BLASTX nr result
ID: Glycyrrhiza34_contig00018162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018162 (721 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007149701.1 hypothetical protein PHAVU_005G091800g [Phaseolus... 98 5e-20 XP_007149700.1 hypothetical protein PHAVU_005G091800g [Phaseolus... 98 6e-20 XP_014521956.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 2e-18 XP_014521951.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 3e-18 KHN27972.1 Pentatricopeptide repeat-containing protein, mitochon... 89 2e-16 XP_003539564.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 2e-16 XP_017425688.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 3e-16 XP_017425686.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-16 XP_013464808.1 PPR containing plant protein, putative [Medicago ... 82 2e-14 XP_003596634.1 PPR containing plant protein, putative [Medicago ... 82 2e-14 XP_004487606.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 3e-12 XP_004487605.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 3e-12 XP_019458206.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-09 OIW03158.1 hypothetical protein TanjilG_11795 [Lupinus angustifo... 69 1e-09 XP_016203151.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-07 XP_016203154.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 4e-07 XP_016169916.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-06 XP_016169917.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-06 XP_015936507.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-06 >XP_007149701.1 hypothetical protein PHAVU_005G091800g [Phaseolus vulgaris] ESW21695.1 hypothetical protein PHAVU_005G091800g [Phaseolus vulgaris] Length = 434 Score = 97.8 bits (242), Expect = 5e-20 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 7/98 (7%) Frame = -3 Query: 317 YVRNLCTGFRSRSHTELNTCNPQ---SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDV 147 YVRNL TGFRSRS T+ T PQ SSS L LSE+ +D LSSLKL+R SDS DS+ Sbjct: 5 YVRNLSTGFRSRSATKGATSKPQPSSSSSNSLCLSELQEDFTLSSLKLKRLSDSDDSASG 64 Query: 146 AFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFHAG+ K+P+SE+I GA EF+ +SWL Sbjct: 65 VFKHISSIFHAGKPVKQPDSEKIDGAKEFERVPNLSWL 102 >XP_007149700.1 hypothetical protein PHAVU_005G091800g [Phaseolus vulgaris] ESW21694.1 hypothetical protein PHAVU_005G091800g [Phaseolus vulgaris] Length = 445 Score = 97.8 bits (242), Expect = 6e-20 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 7/98 (7%) Frame = -3 Query: 317 YVRNLCTGFRSRSHTELNTCNPQ---SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDV 147 YVRNL TGFRSRS T+ T PQ SSS L LSE+ +D LSSLKL+R SDS DS+ Sbjct: 5 YVRNLSTGFRSRSATKGATSKPQPSSSSSNSLCLSELQEDFTLSSLKLKRLSDSDDSASG 64 Query: 146 AFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFHAG+ K+P+SE+I GA EF+ +SWL Sbjct: 65 VFKHISSIFHAGKPVKQPDSEKIDGAKEFERVPNLSWL 102 >XP_014521956.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Vigna radiata var. radiata] Length = 422 Score = 93.2 bits (230), Expect = 2e-18 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 8/98 (8%) Frame = -3 Query: 314 VRNLCTGFRSRSHTELNTCNPQ----SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDV 147 +RNL TGFR RS ++ T PQ SSST L LSE+ +D LSSLKL++ SDSGDS++ Sbjct: 6 IRNLSTGFR-RSASKGATSKPQPSSSSSSTSLCLSELDEDFTLSSLKLKQPSDSGDSANG 64 Query: 146 AFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFHAG+S KKP S EI GA EF+ +SWL Sbjct: 65 VFKHISSIFHAGKSAKKPGSTEIDGAKEFERMQNLSWL 102 >XP_014521951.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna radiata var. radiata] XP_014521952.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna radiata var. radiata] XP_014521953.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna radiata var. radiata] XP_014521955.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna radiata var. radiata] Length = 460 Score = 93.2 bits (230), Expect = 3e-18 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 8/98 (8%) Frame = -3 Query: 314 VRNLCTGFRSRSHTELNTCNPQ----SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDV 147 +RNL TGFR RS ++ T PQ SSST L LSE+ +D LSSLKL++ SDSGDS++ Sbjct: 6 IRNLSTGFR-RSASKGATSKPQPSSSSSSTSLCLSELDEDFTLSSLKLKQPSDSGDSANG 64 Query: 146 AFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFHAG+S KKP S EI GA EF+ +SWL Sbjct: 65 VFKHISSIFHAGKSAKKPGSTEIDGAKEFERMQNLSWL 102 >KHN27972.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 755 Score = 88.6 bits (218), Expect = 2e-16 Identities = 54/97 (55%), Positives = 65/97 (67%), Gaps = 4/97 (4%) Frame = -3 Query: 323 YSYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDVA 144 YSYVR LC+ S S + T QSSS+ L V DDS LSSLKL+R SDSGDSS+ Sbjct: 5 YSYVRRLCSVLGSPS-AKRGTTKTQSSSSSLAKLFVDDDSTLSSLKLKRPSDSGDSSNGV 63 Query: 143 FKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIF+A +S KKP+SEEI G +F+ +SWL Sbjct: 64 FKHISSIFYADKSAKKPDSEEIDGEKKFENMSNLSWL 100 >XP_003539564.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Glycine max] KRH27097.1 hypothetical protein GLYMA_12G214200 [Glycine max] Length = 755 Score = 88.6 bits (218), Expect = 2e-16 Identities = 54/97 (55%), Positives = 65/97 (67%), Gaps = 4/97 (4%) Frame = -3 Query: 323 YSYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSDVA 144 YSYVR LC+ S S + T QSSS+ L V DDS LSSLKL+R SDSGDSS+ Sbjct: 5 YSYVRRLCSVLGSPS-AKRGTTKTQSSSSSLAKLFVDDDSTLSSLKLKRPSDSGDSSNGV 63 Query: 143 FKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIF+A +S KKP+SEEI G +F+ +SWL Sbjct: 64 FKHISSIFYADKSAKKPDSEEIDGEKKFENMSNLSWL 100 >XP_017425688.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Vigna angularis] Length = 422 Score = 87.0 bits (214), Expect = 3e-16 Identities = 55/99 (55%), Positives = 67/99 (67%), Gaps = 8/99 (8%) Frame = -3 Query: 317 YVRNLCTGFRSRSHTELNTCNPQ----SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSD 150 Y+RNL TG R RS ++ T PQ SSST L LSE+ +D LSSLKL++ SDSG S++ Sbjct: 5 YIRNLSTGCR-RSASKGATSKPQPSSSSSSTSLCLSELDEDFTLSSLKLKQPSDSGYSAN 63 Query: 149 VAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFH G+S KKP S EI GA EF+ +SWL Sbjct: 64 RVFKHISSIFHDGKSAKKPGSAEIDGAKEFERVQNLSWL 102 >XP_017425686.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna angularis] XP_017425687.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Vigna angularis] BAT92420.1 hypothetical protein VIGAN_07112900 [Vigna angularis var. angularis] Length = 460 Score = 87.0 bits (214), Expect = 4e-16 Identities = 55/99 (55%), Positives = 67/99 (67%), Gaps = 8/99 (8%) Frame = -3 Query: 317 YVRNLCTGFRSRSHTELNTCNPQ----SSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSSD 150 Y+RNL TG R RS ++ T PQ SSST L LSE+ +D LSSLKL++ SDSG S++ Sbjct: 5 YIRNLSTGCR-RSASKGATSKPQPSSSSSSTSLCLSELDEDFTLSSLKLKQPSDSGYSAN 63 Query: 149 VAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 FK ISSIFH G+S KKP S EI GA EF+ +SWL Sbjct: 64 RVFKHISSIFHDGKSAKKPGSAEIDGAKEFERVQNLSWL 102 >XP_013464808.1 PPR containing plant protein, putative [Medicago truncatula] KEH38843.1 PPR containing plant protein, putative [Medicago truncatula] Length = 394 Score = 82.0 bits (201), Expect = 2e-14 Identities = 50/109 (45%), Positives = 72/109 (66%), Gaps = 6/109 (5%) Frame = -3 Query: 341 MRYFHSYSYVRNLCTGFRSRSHTELN--TCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSD 168 MRYFH +R +C+ FR+ S T+ N + + SSST H S++ DS L+SL L R+SD Sbjct: 1 MRYFH---IIRTICSPFRTHSPTKFNLHSSSFSSSSTTTH-SKLDVDSILASLNLHRNSD 56 Query: 167 SGDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWLPKMP 33 S + S+ F +ISSIF+ G+S K+P++E+I ANEF+ +S LP MP Sbjct: 57 SDELSEAVFHQISSIFYGGESVKRPDTEKIDAANEFERILNVSQLPNMP 105 >XP_003596634.1 PPR containing plant protein, putative [Medicago truncatula] AES66885.1 PPR containing plant protein, putative [Medicago truncatula] Length = 523 Score = 82.0 bits (201), Expect = 2e-14 Identities = 50/109 (45%), Positives = 72/109 (66%), Gaps = 6/109 (5%) Frame = -3 Query: 341 MRYFHSYSYVRNLCTGFRSRSHTELN--TCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSD 168 MRYFH +R +C+ FR+ S T+ N + + SSST H S++ DS L+SL L R+SD Sbjct: 1 MRYFH---IIRTICSPFRTHSPTKFNLHSSSFSSSSTTTH-SKLDVDSILASLNLHRNSD 56 Query: 167 SGDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWLPKMP 33 S + S+ F +ISSIF+ G+S K+P++E+I ANEF+ +S LP MP Sbjct: 57 SDELSEAVFHQISSIFYGGESVKRPDTEKIDAANEFERILNVSQLPNMP 105 >XP_004487606.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Cicer arietinum] Length = 521 Score = 75.9 bits (185), Expect = 3e-12 Identities = 49/97 (50%), Positives = 62/97 (63%), Gaps = 2/97 (2%) Frame = -3 Query: 341 MRYFHSYSYVRNLCTG-FRSRSHTELNTCNPQ-SSSTPLHLSEVLDDSPLSSLKLQRHSD 168 MRY++ +RNLCT FRS S T + SSS+ LS+ DS L+SLKL R+SD Sbjct: 1 MRYYY---VIRNLCTTRFRSHSATTFTAHSSSFSSSSSSTLSKFDGDSILASLKLNRNSD 57 Query: 167 SGDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD 57 S + SD FK++SSIF+ QS K P EEI GANEF+ Sbjct: 58 SDELSDDVFKQVSSIFYGDQSVKTPIYEEIDGANEFE 94 >XP_004487605.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Cicer arietinum] Length = 522 Score = 75.9 bits (185), Expect = 3e-12 Identities = 49/97 (50%), Positives = 62/97 (63%), Gaps = 2/97 (2%) Frame = -3 Query: 341 MRYFHSYSYVRNLCTG-FRSRSHTELNTCNPQ-SSSTPLHLSEVLDDSPLSSLKLQRHSD 168 MRY++ +RNLCT FRS S T + SSS+ LS+ DS L+SLKL R+SD Sbjct: 1 MRYYY---VIRNLCTTRFRSHSATTFTAHSSSFSSSSSSTLSKFDGDSILASLKLNRNSD 57 Query: 167 SGDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD 57 S + SD FK++SSIF+ QS K P EEI GANEF+ Sbjct: 58 SDELSDDVFKQVSSIFYGDQSVKTPIYEEIDGANEFE 94 >XP_019458206.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Lupinus angustifolius] Length = 761 Score = 68.6 bits (166), Expect = 1e-09 Identities = 46/104 (44%), Positives = 64/104 (61%), Gaps = 4/104 (3%) Frame = -3 Query: 344 EMRYFHSYSYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDS 165 +MRY + ++R RSRS + N N S S+ L +S DS LSSLK++R S S Sbjct: 5 QMRYSYCSYFLRRRNLSTRSRSSSSPNN-NFNSESSSL-VSGFDADSTLSSLKIKRPSLS 62 Query: 164 GDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 DSS++ FK+ISSIF+ G+ K+P SE+I G EF+ +SWL Sbjct: 63 DDSSNLVFKQISSIFYGGELVKRPGSEKIDGEKEFERTPKISWL 106 >OIW03158.1 hypothetical protein TanjilG_11795 [Lupinus angustifolius] Length = 846 Score = 68.6 bits (166), Expect = 1e-09 Identities = 46/104 (44%), Positives = 64/104 (61%), Gaps = 4/104 (3%) Frame = -3 Query: 344 EMRYFHSYSYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDS 165 +MRY + ++R RSRS + N N S S+ L +S DS LSSLK++R S S Sbjct: 5 QMRYSYCSYFLRRRNLSTRSRSSSSPNN-NFNSESSSL-VSGFDADSTLSSLKIKRPSLS 62 Query: 164 GDSSDVAFKRISSIFHAGQSGKKPNSEEIGGANEFD----MSWL 45 DSS++ FK+ISSIF+ G+ K+P SE+I G EF+ +SWL Sbjct: 63 DDSSNLVFKQISSIFYGGELVKRPGSEKIDGEKEFERTPKISWL 106 >XP_016203151.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Arachis ipaensis] Length = 761 Score = 62.0 bits (149), Expect = 2e-07 Identities = 48/101 (47%), Positives = 60/101 (59%), Gaps = 6/101 (5%) Frame = -3 Query: 329 HSY-SYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSS 153 HSY SYVRNL TGFRSRS +S++ SE DS L+SLKL++ S DSS Sbjct: 3 HSYFSYVRNL-TGFRSRS---------RSAAYSSFFSEFDGDSTLASLKLKQSPASDDSS 52 Query: 152 DVAFKRISSIFHAGQ-SGKKPNSEEIGGANEFD----MSWL 45 +VAFK+ISSI++ S KKP S+ A E +SWL Sbjct: 53 NVAFKKISSIYYGDSISVKKPMSKRNDNAKESQSQPGISWL 93 >XP_016203154.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X4 [Arachis ipaensis] Length = 575 Score = 60.8 bits (146), Expect = 4e-07 Identities = 45/91 (49%), Positives = 56/91 (61%), Gaps = 2/91 (2%) Frame = -3 Query: 329 HSY-SYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSS 153 HSY SYVRNL TGFRSRS +S++ SE DS L+SLKL++ S DSS Sbjct: 3 HSYFSYVRNL-TGFRSRS---------RSAAYSSFFSEFDGDSTLASLKLKQSPASDDSS 52 Query: 152 DVAFKRISSIFHAGQ-SGKKPNSEEIGGANE 63 +VAFK+ISSI++ S KKP S+ A E Sbjct: 53 NVAFKKISSIYYGDSISVKKPMSKRNDNAKE 83 >XP_016169916.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Arachis ipaensis] Length = 478 Score = 58.9 bits (141), Expect = 2e-06 Identities = 47/101 (46%), Positives = 59/101 (58%), Gaps = 6/101 (5%) Frame = -3 Query: 329 HSY-SYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSS 153 HSY SYVRNL T FRSRS +S++ SE DS L+SLKL++ S DSS Sbjct: 39 HSYFSYVRNL-TRFRSRS---------RSAAYSSFFSEFDGDSTLASLKLKQSPASDDSS 88 Query: 152 DVAFKRISSIFHAGQ-SGKKPNSEEIGGANEF----DMSWL 45 +VAFK+ISSI++ S KKP S+ A E +SWL Sbjct: 89 NVAFKKISSIYYGDSISVKKPMSKRNDNAKESQSQPSISWL 129 >XP_016169917.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Arachis ipaensis] Length = 568 Score = 58.9 bits (141), Expect = 2e-06 Identities = 47/101 (46%), Positives = 59/101 (58%), Gaps = 6/101 (5%) Frame = -3 Query: 329 HSY-SYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSS 153 HSY SYVRNL T FRSRS +S++ SE DS L+SLKL++ S DSS Sbjct: 39 HSYFSYVRNL-TRFRSRS---------RSAAYSSFFSEFDGDSTLASLKLKQSPASDDSS 88 Query: 152 DVAFKRISSIFHAGQ-SGKKPNSEEIGGANEF----DMSWL 45 +VAFK+ISSI++ S KKP S+ A E +SWL Sbjct: 89 NVAFKKISSIYYGDSISVKKPMSKRNDNAKESQSQPSISWL 129 >XP_015936507.1 PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Arachis duranensis] Length = 761 Score = 57.4 bits (137), Expect = 6e-06 Identities = 46/101 (45%), Positives = 59/101 (58%), Gaps = 6/101 (5%) Frame = -3 Query: 329 HSY-SYVRNLCTGFRSRSHTELNTCNPQSSSTPLHLSEVLDDSPLSSLKLQRHSDSGDSS 153 HSY SYVRN+ T FRSRS +S++ SE DS L+SLKL++ S DSS Sbjct: 3 HSYFSYVRNV-TRFRSRS---------RSAAYSSFFSEFDGDSTLASLKLKQSPASDDSS 52 Query: 152 DVAFKRISSIFHAGQ-SGKKPNSEEIGGANEFD----MSWL 45 +VAFK+ISSI++ S KKP S+ A E +SWL Sbjct: 53 NVAFKKISSIYYGDSISVKKPISKRNDNAKESQSQPGISWL 93