BLASTX nr result
ID: Glycyrrhiza34_contig00018130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018130 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU18422.1 hypothetical protein TSUD_203100 [Trifolium subterran... 75 7e-14 GAU18421.1 hypothetical protein TSUD_203110 [Trifolium subterran... 75 8e-14 XP_003623405.1 PPR containing plant-like protein [Medicago trunc... 72 1e-12 XP_004492508.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 GAU17155.1 hypothetical protein TSUD_177850 [Trifolium subterran... 69 5e-12 XP_019423092.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 2e-10 KYP63608.1 Pentatricopeptide repeat-containing protein At3g18020... 63 2e-09 KHN40689.1 Pentatricopeptide repeat-containing protein [Glycine ... 63 2e-09 XP_014625770.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_015949037.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_016193824.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_016193821.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_015949033.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 >GAU18422.1 hypothetical protein TSUD_203100 [Trifolium subterraneum] Length = 427 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMDNEVSQDRSKFV 142 RN + PDCVTWR+LHKL S VR HT SED TLST+ E DMD++ SQDR K++ Sbjct: 360 RNEVIPDCVTWRVLHKLQSNVRKHTPSEDLTLSTVDESVDMDDKASQDRRKWI 412 >GAU18421.1 hypothetical protein TSUD_203110 [Trifolium subterraneum] Length = 922 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMDNEVSQDRSKFV 142 RN + PDCVTWR+LHKL S VR HT SED TLST+ E DMD++ SQDR K++ Sbjct: 855 RNEVIPDCVTWRVLHKLQSNVRKHTPSEDLTLSTVDESVDMDDKASQDRRKWI 907 >XP_003623405.1 PPR containing plant-like protein [Medicago truncatula] AES79623.1 PPR containing plant-like protein [Medicago truncatula] Length = 737 Score = 72.0 bits (175), Expect = 1e-12 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMDNEVSQDRSKF 145 +NG+ PDCVTWRILHKL SKV HT ED TLST EG DMDN+ SQ+R K+ Sbjct: 600 KNGVAPDCVTWRILHKLQSKVTKHTPFEDPTLST--EGVDMDNKASQNRRKW 649 >XP_004492508.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Cicer arietinum] Length = 667 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMDNEVSQDRSKF 145 RNG+ PDCVTWRIL+KL SKVR H+ SED TIYEG+DMDN+ QD K+ Sbjct: 604 RNGVAPDCVTWRILYKLQSKVRKHSKSED---PTIYEGDDMDNKAIQDIRKW 652 >GAU17155.1 hypothetical protein TSUD_177850 [Trifolium subterraneum] Length = 240 Score = 68.9 bits (167), Expect = 5e-12 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDM 178 RNG+ PDCVTWR+LHKL S VR HT SED TLST+ EG+DM Sbjct: 172 RNGVIPDCVTWRVLHKLQSNVRKHTSSEDLTLSTVDEGDDM 212 >XP_019423092.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Lupinus angustifolius] OIW17503.1 hypothetical protein TanjilG_22615 [Lupinus angustifolius] Length = 653 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEG 187 +NG+ PDCVTWRIL+KLH KVR H SED TLSTIYEG Sbjct: 616 KNGVNPDCVTWRILNKLHGKVRKHPGSEDPTLSTIYEG 653 >KYP63608.1 Pentatricopeptide repeat-containing protein At3g18020 family [Cajanus cajan] Length = 503 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDM 178 +NG++PD VTWRIL KLH KVR + SED T+STIYEG DM Sbjct: 449 KNGLSPDSVTWRILDKLHGKVRKNIHSEDSTMSTIYEGPDM 489 >KHN40689.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 525 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMD 175 +NG+TPD VTWRIL KLH KVR SED T+ST YEG DM+ Sbjct: 484 KNGLTPDSVTWRILDKLHGKVRKDIHSEDPTMSTTYEGHDME 525 >XP_014625770.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Glycine max] KRH00347.1 hypothetical protein GLYMA_18G207800 [Glycine max] Length = 650 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYEGEDMD 175 +NG+TPD VTWRIL KLH KVR SED T+ST YEG DM+ Sbjct: 609 KNGLTPDSVTWRILDKLHGKVRKDIHSEDPTMSTTYEGHDME 650 >XP_015949037.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Arachis duranensis] Length = 257 Score = 56.6 bits (135), Expect = 2e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYE 190 RN +TPDCVTWRIL KLH KVR H ED+ LS +Y+ Sbjct: 215 RNKLTPDCVTWRILDKLHGKVRTHNHFEDRNLSALYD 251 >XP_016193824.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Arachis ipaensis] Length = 651 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYE 190 RN +TPDCVTWRIL KLH KVR H ED+ LS +Y+ Sbjct: 609 RNKLTPDCVTWRILDKLHGKVRTHNHFEDRNLSALYD 645 >XP_016193821.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Arachis ipaensis] Length = 653 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYE 190 RN +TPDCVTWRIL KLH KVR H ED+ LS +Y+ Sbjct: 611 RNKLTPDCVTWRILDKLHGKVRTHNHFEDRNLSALYD 647 >XP_015949033.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Arachis duranensis] Length = 685 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 300 RNGMTPDCVTWRILHKLHSKVRNHTLSEDQTLSTIYE 190 RN +TPDCVTWRIL KLH KVR H ED+ LS +Y+ Sbjct: 643 RNKLTPDCVTWRILDKLHGKVRTHNHFEDRNLSALYD 679