BLASTX nr result
ID: Glycyrrhiza34_contig00017574
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017574 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterran... 54 4e-14 KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus c... 69 2e-11 >GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterraneum] Length = 291 Score = 54.3 bits (129), Expect(2) = 4e-14 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 259 LLCNFFLEGNLPACLLSFYPQICIFS 182 L NFFLEGNLPACLLSFYPQICIFS Sbjct: 53 LSANFFLEGNLPACLLSFYPQICIFS 78 Score = 50.8 bits (120), Expect(2) = 4e-14 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 330 RVDMKSGTSTKGKYAELLSWFANLFSAIFF 241 RVDMKSGT+TKGKYAELLSW ANL SA FF Sbjct: 30 RVDMKSGTTTKGKYAELLSWLANL-SANFF 58 >KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus cajan] Length = 354 Score = 68.9 bits (167), Expect = 2e-11 Identities = 41/72 (56%), Positives = 47/72 (65%) Frame = -2 Query: 330 RVDMKSGTSTKGKYAELLSWFANLFSAIFFWKETFLLVCSPSIHRSAFSHLMLIRHSLPS 151 RVDMKSG + G + L IFFWKETFLLVC PS +RSAFSHL +IRHSL S Sbjct: 30 RVDMKSGKTLGGNMLSKVLACQPL--PIFFWKETFLLVCPPSTYRSAFSHL-IIRHSLTS 86 Query: 150 SPNIDIFIPSEC 115 S + +I I EC Sbjct: 87 SSSPNIDISPEC 98