BLASTX nr result
ID: Glycyrrhiza34_contig00017448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017448 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY75244.1 GTP-binding protein SAR1A, partial [Ananas comosus] 94 2e-23 KDO87024.1 hypothetical protein CISIN_1g0294371mg, partial [Citr... 94 2e-23 XP_019441202.1 PREDICTED: GTP-binding protein SAR1B [Lupinus ang... 96 3e-23 XP_010096809.1 GTP-binding protein [Morus notabilis] EXB66050.1 ... 94 7e-23 AFK44533.1 unknown [Lotus japonicus] 94 7e-23 XP_019422685.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinu... 95 8e-23 XP_019420080.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinu... 95 8e-23 XP_018846147.1 PREDICTED: GTP-binding protein SAR1A isoform X2 [... 94 1e-22 KJB24406.1 hypothetical protein B456_004G144100 [Gossypium raimo... 93 1e-22 XP_019706124.1 PREDICTED: GTP-binding protein SAR1A, partial [El... 92 1e-22 NP_001318907.1 Ras-related small GTP-binding family protein [Ara... 92 1e-22 XP_004495668.1 PREDICTED: GTP-binding protein SAR1A-like [Cicer ... 94 2e-22 XP_010091899.1 GTP-binding protein [Morus notabilis] EXB47146.1 ... 94 2e-22 XP_008355500.1 PREDICTED: GTP-binding protein SAR1A [Malus domes... 94 2e-22 XP_020113800.1 GTP-binding protein SAR1A-like [Ananas comosus] 94 2e-22 XP_018820703.1 PREDICTED: GTP-binding protein SAR1A-like [Juglan... 94 2e-22 GAU11442.1 hypothetical protein TSUD_344330 [Trifolium subterran... 94 2e-22 OAY80232.1 GTP-binding protein SAR1A [Ananas comosus] 94 2e-22 OAY48748.1 hypothetical protein MANES_05G002700 [Manihot esculenta] 94 2e-22 KYP71291.1 GTP-binding protein SAR1A [Cajanus cajan] 94 2e-22 >OAY75244.1 GTP-binding protein SAR1A, partial [Ananas comosus] Length = 106 Score = 93.6 bits (231), Expect = 2e-23 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 63 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 106 >KDO87024.1 hypothetical protein CISIN_1g0294371mg, partial [Citrus sinensis] Length = 106 Score = 93.6 bits (231), Expect = 2e-23 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 63 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 106 >XP_019441202.1 PREDICTED: GTP-binding protein SAR1B [Lupinus angustifolius] Length = 193 Score = 95.9 bits (237), Expect = 3e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 193 >XP_010096809.1 GTP-binding protein [Morus notabilis] EXB66050.1 GTP-binding protein [Morus notabilis] Length = 149 Score = 93.6 bits (231), Expect = 7e-23 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 106 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 149 >AFK44533.1 unknown [Lotus japonicus] Length = 149 Score = 93.6 bits (231), Expect = 7e-23 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNLSDSNVRPMEVFMCSIV+KMGYGDGFKW+SQYIK Sbjct: 106 NFTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 149 >XP_019422685.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinus angustifolius] OIW17475.1 hypothetical protein TanjilG_22587 [Lupinus angustifolius] Length = 193 Score = 94.7 bits (234), Expect = 8e-23 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 193 >XP_019420080.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinus angustifolius] OIV95257.1 hypothetical protein TanjilG_26954 [Lupinus angustifolius] Length = 193 Score = 94.7 bits (234), Expect = 8e-23 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNLSDSNVRPMEV+MCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLSDSNVRPMEVYMCSIVRKMGYGDGFKWLSQYIK 193 >XP_018846147.1 PREDICTED: GTP-binding protein SAR1A isoform X2 [Juglans regia] Length = 165 Score = 93.6 bits (231), Expect = 1e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 122 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 165 >KJB24406.1 hypothetical protein B456_004G144100 [Gossypium raimondii] Length = 147 Score = 92.8 bits (229), Expect = 1e-22 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKW+SQYIK Sbjct: 104 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYIK 147 >XP_019706124.1 PREDICTED: GTP-binding protein SAR1A, partial [Elaeis guineensis] Length = 121 Score = 92.0 bits (227), Expect = 1e-22 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYG+GFKWLSQYIK Sbjct: 78 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 121 >NP_001318907.1 Ras-related small GTP-binding family protein [Arabidopsis thaliana] AEE27450.1 Ras-related small GTP-binding family protein [Arabidopsis thaliana] Length = 122 Score = 92.0 bits (227), Expect = 1e-22 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYG+GFKWLSQYIK Sbjct: 79 NFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 122 >XP_004495668.1 PREDICTED: GTP-binding protein SAR1A-like [Cicer arietinum] Length = 193 Score = 94.0 bits (232), Expect = 2e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNLSDS+VRPMEVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLSDSDVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 193 >XP_010091899.1 GTP-binding protein [Morus notabilis] EXB47146.1 GTP-binding protein [Morus notabilis] Length = 189 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 146 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 189 >XP_008355500.1 PREDICTED: GTP-binding protein SAR1A [Malus domestica] Length = 192 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 149 NFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 192 >XP_020113800.1 GTP-binding protein SAR1A-like [Ananas comosus] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >XP_018820703.1 PREDICTED: GTP-binding protein SAR1A-like [Juglans regia] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >GAU11442.1 hypothetical protein TSUD_344330 [Trifolium subterraneum] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNLSDSNVRPMEVFMCSIV+KMGYGDGFKW+SQYIK Sbjct: 150 NFTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >OAY80232.1 GTP-binding protein SAR1A [Ananas comosus] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >OAY48748.1 hypothetical protein MANES_05G002700 [Manihot esculenta] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRP+EVFMCSIVRKMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >KYP71291.1 GTP-binding protein SAR1A [Cajanus cajan] Length = 193 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 204 NFTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 73 NFTTGKGKVNL+DSNVRPMEVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 150 NFTTGKGKVNLADSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 193