BLASTX nr result
ID: Glycyrrhiza34_contig00017372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017372 (910 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN42856.1 Putative glycerol-3-phosphate transporter 5 [Glycine ... 106 3e-22 XP_003546598.1 PREDICTED: putative glycerol-3-phosphate transpor... 106 3e-22 XP_003533881.1 PREDICTED: putative glycerol-3-phosphate transpor... 105 9e-22 KYP36854.1 Sugar phosphate exchanger 2 [Cajanus cajan] 101 2e-20 XP_004502997.1 PREDICTED: putative glycerol-3-phosphate transpor... 101 2e-20 XP_014498667.1 PREDICTED: putative glycerol-3-phosphate transpor... 100 7e-20 XP_007138450.1 hypothetical protein PHAVU_009G210000g [Phaseolus... 99 1e-19 XP_017422195.1 PREDICTED: putative glycerol-3-phosphate transpor... 99 2e-19 GAU13300.1 hypothetical protein TSUD_42540 [Trifolium subterraneum] 97 6e-19 XP_013464044.1 glycerol-3-phosphate transporter [Medicago trunca... 97 8e-19 XP_019417449.1 PREDICTED: putative glycerol-3-phosphate transpor... 96 2e-18 XP_015955125.1 PREDICTED: putative glycerol-3-phosphate transpor... 93 1e-17 XP_007201950.1 hypothetical protein PRUPE_ppa004556mg [Prunus pe... 93 1e-17 XP_018503456.1 PREDICTED: putative glycerol-3-phosphate transpor... 92 2e-17 XP_009338411.1 PREDICTED: putative glycerol-3-phosphate transpor... 92 2e-17 XP_009358520.1 PREDICTED: putative glycerol-3-phosphate transpor... 92 2e-17 XP_007013667.2 PREDICTED: putative glycerol-3-phosphate transpor... 92 4e-17 XP_016651982.1 PREDICTED: LOW QUALITY PROTEIN: putative glycerol... 92 4e-17 XP_016189281.1 PREDICTED: putative glycerol-3-phosphate transpor... 91 1e-16 XP_010049894.1 PREDICTED: putative glycerol-3-phosphate transpor... 90 2e-16 >KHN42856.1 Putative glycerol-3-phosphate transporter 5 [Glycine soja] Length = 492 Score = 106 bits (265), Expect = 3e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSKS SLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSKSLSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 53 >XP_003546598.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Glycine max] KRH12876.1 hypothetical protein GLYMA_15G201400 [Glycine max] Length = 492 Score = 106 bits (265), Expect = 3e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSKS SLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSKSLSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 53 >XP_003533881.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Glycine max] KHN15428.1 Putative glycerol-3-phosphate transporter 5 [Glycine soja] KRH37885.1 hypothetical protein GLYMA_09G096500 [Glycine max] Length = 493 Score = 105 bits (261), Expect = 9e-22 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSKS SLAPALT FPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSKSLSLAPALTFFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 53 >KYP36854.1 Sugar phosphate exchanger 2 [Cajanus cajan] Length = 492 Score = 101 bits (251), Expect = 2e-20 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQS+S SLAPALTLFP LKPPHKTLLFH+ICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSESLSLAPALTLFPALKPPHKTLLFHRICVLVITFLAYASFHASRKPPSIV 53 >XP_004502997.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Cicer arietinum] Length = 502 Score = 101 bits (251), Expect = 2e-20 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = +3 Query: 744 IRMQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 ++ SKS SLAPAL LFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSNSKSLSLAPALNLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 55 >XP_014498667.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Vigna radiata var. radiata] Length = 492 Score = 99.8 bits (247), Expect = 7e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQS+S S PALTLFPGLKPPHKTLLFH+ICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSESLSQTPALTLFPGLKPPHKTLLFHKICVLVITFLAYASFHASRKPPSIV 53 >XP_007138450.1 hypothetical protein PHAVU_009G210000g [Phaseolus vulgaris] ESW10444.1 hypothetical protein PHAVU_009G210000g [Phaseolus vulgaris] Length = 492 Score = 99.0 bits (245), Expect = 1e-19 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQS+S S PAL LFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSESLSQTPALKLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 53 >XP_017422195.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Vigna angularis] KOM40092.1 hypothetical protein LR48_Vigan04g029000 [Vigna angularis] BAT79884.1 hypothetical protein VIGAN_02282500 [Vigna angularis var. angularis] Length = 492 Score = 98.6 bits (244), Expect = 2e-19 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQS+S S PALTL+PGLKPPHKTLLFH+ICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSESLSQTPALTLYPGLKPPHKTLLFHKICVLVITFLAYASFHASRKPPSIV 53 >GAU13300.1 hypothetical protein TSUD_42540 [Trifolium subterraneum] Length = 510 Score = 97.1 bits (240), Expect = 6e-19 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +3 Query: 744 IRMQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 ++ SKS SLAPAL LFP L PPHKTLLFHQICVLVITFLAYASFHASRKPPSIV Sbjct: 1 MQSNSKSLSLAPALNLFPNLNPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 55 >XP_013464044.1 glycerol-3-phosphate transporter [Medicago truncatula] KEH38079.1 glycerol-3-phosphate transporter [Medicago truncatula] Length = 489 Score = 96.7 bits (239), Expect = 8e-19 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +3 Query: 756 SKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 SKS SLAPAL LFP LKPPHKTLLFH+ICVL+ITFLAYASFHASRKPPSIV Sbjct: 5 SKSLSLAPALNLFPNLKPPHKTLLFHKICVLIITFLAYASFHASRKPPSIV 55 >XP_019417449.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Lupinus angustifolius] OIV97263.1 hypothetical protein TanjilG_10797 [Lupinus angustifolius] Length = 492 Score = 95.5 bits (236), Expect = 2e-18 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSKS S APALTLFPGLKPP+KTL+FHQICVL ITFLAYASFHASRKP SIV Sbjct: 1 MQSKSLSQAPALTLFPGLKPPNKTLIFHQICVLSITFLAYASFHASRKPSSIV 53 >XP_015955125.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Arachis duranensis] XP_015955126.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Arachis duranensis] Length = 498 Score = 93.2 bits (230), Expect = 1e-17 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 M+ S SL P LTLFPGLKPP+KTLLFHQ CVLVITFLAYASFHASRKPPSIV Sbjct: 3 MEFNSLSLPPVLTLFPGLKPPNKTLLFHQTCVLVITFLAYASFHASRKPPSIV 55 >XP_007201950.1 hypothetical protein PRUPE_ppa004556mg [Prunus persica] ONH98588.1 hypothetical protein PRUPE_7G255700 [Prunus persica] Length = 503 Score = 93.2 bits (230), Expect = 1e-17 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+SSLAPAL FP LKPPHKTL FHQ VL+ITFLAYASFHASRKPPSIV Sbjct: 1 MQSKTSSLAPALNYFPTLKPPHKTLAFHQFSVLIITFLAYASFHASRKPPSIV 53 >XP_018503456.1 PREDICTED: putative glycerol-3-phosphate transporter 5 isoform X2 [Pyrus x bretschneideri] Length = 470 Score = 92.4 bits (228), Expect = 2e-17 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+ +LAPAL FP LKPPHKTL FHQI VL+ITFLAYASFHASRKPPSIV Sbjct: 1 MQSKTLTLAPALNFFPNLKPPHKTLAFHQISVLIITFLAYASFHASRKPPSIV 53 >XP_009338411.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Pyrus x bretschneideri] XP_018498898.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Pyrus x bretschneideri] Length = 498 Score = 92.4 bits (228), Expect = 2e-17 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+ +LAPAL FP LKPPHKTL FHQI VL+ITFLAYASFHASRKPPSIV Sbjct: 1 MQSKTLTLAPALNFFPNLKPPHKTLAFHQISVLIITFLAYASFHASRKPPSIV 53 >XP_009358520.1 PREDICTED: putative glycerol-3-phosphate transporter 5 isoform X1 [Pyrus x bretschneideri] XP_018503455.1 PREDICTED: putative glycerol-3-phosphate transporter 5 isoform X1 [Pyrus x bretschneideri] Length = 500 Score = 92.4 bits (228), Expect = 2e-17 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+ +LAPAL FP LKPPHKTL FHQI VL+ITFLAYASFHASRKPPSIV Sbjct: 1 MQSKTLTLAPALNFFPNLKPPHKTLAFHQISVLIITFLAYASFHASRKPPSIV 53 >XP_007013667.2 PREDICTED: putative glycerol-3-phosphate transporter 5 [Theobroma cacao] Length = 497 Score = 91.7 bits (226), Expect = 4e-17 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+ SLAP TLFP LKPPHKTL+FHQI + ++TFLAYASFHASRKPPSIV Sbjct: 1 MQSKTVSLAPGFTLFPTLKPPHKTLIFHQILIFILTFLAYASFHASRKPPSIV 53 >XP_016651982.1 PREDICTED: LOW QUALITY PROTEIN: putative glycerol-3-phosphate transporter 5 [Prunus mume] Length = 499 Score = 91.7 bits (226), Expect = 4e-17 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQSK+SSLAPAL FP LKPPHKTL FH+ VL+ITFLAYASFHASRKPPSIV Sbjct: 1 MQSKTSSLAPALNYFPTLKPPHKTLAFHRFSVLIITFLAYASFHASRKPPSIV 53 >XP_016189281.1 PREDICTED: putative glycerol-3-phosphate transporter 5 [Arachis ipaensis] Length = 498 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 M+ S SL P LTLFPGLKPP+KT LFHQ CVLV+TFLAYASFHASRKPPSIV Sbjct: 3 MEFNSLSLPPVLTLFPGLKPPNKTRLFHQTCVLVVTFLAYASFHASRKPPSIV 55 >XP_010049894.1 PREDICTED: putative glycerol-3-phosphate transporter 5 isoform X2 [Eucalyptus grandis] Length = 474 Score = 89.7 bits (221), Expect = 2e-16 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +3 Query: 750 MQSKSSSLAPALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIV 908 MQ S +LAP L LFP LKPPH+TLLFHQICVL++TFLAYASFHASRKP SIV Sbjct: 1 MQPSSRTLAPILVLFPTLKPPHRTLLFHQICVLILTFLAYASFHASRKPQSIV 53