BLASTX nr result
ID: Glycyrrhiza34_contig00017340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017340 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU33434.1 hypothetical protein TSUD_380700 [Trifolium subterran... 55 2e-06 XP_013462802.1 polyadenylate-binding protein RBP47B [Medicago tr... 54 6e-06 >GAU33434.1 hypothetical protein TSUD_380700 [Trifolium subterraneum] Length = 270 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 AAAQPKGRQEALSSWSLELISAEMVTILVHVLA 101 AA QPKG QEALSS SLELISAEM+TILVHVLA Sbjct: 238 AATQPKGCQEALSSRSLELISAEMITILVHVLA 270 >XP_013462802.1 polyadenylate-binding protein RBP47B [Medicago truncatula] KEH36838.1 polyadenylate-binding protein RBP47B [Medicago truncatula] Length = 271 Score = 53.5 bits (127), Expect = 6e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +3 Query: 3 AAAQPKGRQEALSSWSLELISAEMVTILVHVLA 101 A QPKG QEALSS SLELISAEMVTILVHVLA Sbjct: 239 ATTQPKGCQEALSSRSLELISAEMVTILVHVLA 271