BLASTX nr result
ID: Glycyrrhiza34_contig00017277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017277 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003552765.1 PREDICTED: pentatricopeptide repeat-containing pr... 223 2e-67 XP_017407754.1 PREDICTED: pentatricopeptide repeat-containing pr... 219 1e-65 XP_014521683.1 PREDICTED: pentatricopeptide repeat-containing pr... 218 3e-65 XP_007163838.1 hypothetical protein PHAVU_001G268500g [Phaseolus... 218 3e-65 XP_003538522.1 PREDICTED: pentatricopeptide repeat-containing pr... 218 3e-65 KYP57038.1 hypothetical protein KK1_003292 [Cajanus cajan] 211 2e-63 XP_018844776.1 PREDICTED: pentatricopeptide repeat-containing pr... 210 3e-62 XP_004502213.1 PREDICTED: pentatricopeptide repeat-containing pr... 206 1e-60 XP_016188467.1 PREDICTED: pentatricopeptide repeat-containing pr... 204 5e-60 XP_015953237.1 PREDICTED: pentatricopeptide repeat-containing pr... 203 1e-59 OAY24567.1 hypothetical protein MANES_17G025500 [Manihot esculenta] 201 6e-59 XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing pr... 201 7e-59 XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing pr... 200 2e-58 XP_002276556.1 PREDICTED: pentatricopeptide repeat-containing pr... 199 5e-58 XP_009125125.1 PREDICTED: pentatricopeptide repeat-containing pr... 199 7e-58 XP_003601624.1 PPR containing plant-like protein [Medicago trunc... 199 7e-58 XP_013647763.1 PREDICTED: pentatricopeptide repeat-containing pr... 197 2e-57 XP_013592391.1 PREDICTED: pentatricopeptide repeat-containing pr... 197 2e-57 XP_015902775.1 PREDICTED: pentatricopeptide repeat-containing pr... 197 2e-57 XP_015879457.1 PREDICTED: pentatricopeptide repeat-containing pr... 197 2e-57 >XP_003552765.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 658 Score = 223 bits (569), Expect = 2e-67 Identities = 108/124 (87%), Positives = 117/124 (94%) Frame = +2 Query: 14 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 193 Y DRSVDMEELL++IGQT NE+EL+AVMSPYN RQLS+RFM SLLSREPDWQRALALLDW Sbjct: 65 YWDRSVDMEELLAAIGQTQNEDELYAVMSPYNGRQLSMRFMVSLLSREPDWQRALALLDW 124 Query: 194 MNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSFGKQG 373 +NDKALYSPSL AYNV+LRNVLRAKQ+HLAHGLFDEMR KGLSPDRYTYSTLITSFGK G Sbjct: 125 INDKALYSPSLFAYNVLLRNVLRAKQWHLAHGLFDEMRQKGLSPDRYTYSTLITSFGKHG 184 Query: 374 MFDS 385 +FDS Sbjct: 185 LFDS 188 >XP_017407754.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vigna angularis] KOM27530.1 hypothetical protein LR48_Vigan434s000600 [Vigna angularis] Length = 676 Score = 219 bits (558), Expect = 1e-65 Identities = 105/128 (82%), Positives = 118/128 (92%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q+ +DRSVDMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR LA Sbjct: 79 QQGTCLDRSVDMEELLAAIGETQNEDELYAVMSPYSGRQLSIRFMVSLLSREPDWQRTLA 138 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+N+KALYSPSL AYNVVLRNVLRAKQ+HLAHGLFDEMRHKGLSPDRYTYSTLITSF Sbjct: 139 LLDWINEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITSF 198 Query: 362 GKQGMFDS 385 K G+FDS Sbjct: 199 AKHGLFDS 206 >XP_014521683.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vigna radiata var. radiata] Length = 676 Score = 218 bits (556), Expect = 3e-65 Identities = 105/128 (82%), Positives = 118/128 (92%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q+ +DRSVDMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR LA Sbjct: 79 QQGTCLDRSVDMEELLAAIGETQNEDELYAVMSPYSGRQLSMRFMVSLLSREPDWQRTLA 138 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+N+KALYSPSL AYNVVLRNVLRAKQ+HLAHGLFDEMRHKGLSPDRYTYSTLITSF Sbjct: 139 LLDWINEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITSF 198 Query: 362 GKQGMFDS 385 K G+FDS Sbjct: 199 AKHGLFDS 206 >XP_007163838.1 hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] ESW35832.1 hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] Length = 677 Score = 218 bits (556), Expect = 3e-65 Identities = 103/128 (80%), Positives = 119/128 (92%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q+ ++DRS+DMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR +A Sbjct: 80 QQATFLDRSMDMEELLAAIGETQNEDELYAVMSPYSGRQLSMRFMVSLLSREPDWQRTVA 139 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+N+KALYSPSL AYNVVLRNVLRAKQ+HLAHGLFDEMRHKGLSPDRYTYSTLITSF Sbjct: 140 LLDWINEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITSF 199 Query: 362 GKQGMFDS 385 K G+FDS Sbjct: 200 AKDGLFDS 207 >XP_003538522.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 667 Score = 218 bits (555), Expect = 3e-65 Identities = 105/124 (84%), Positives = 115/124 (92%) Frame = +2 Query: 14 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 193 Y+DRSVDME LL++IGQT NE+EL+AVMSPYN RQLS+RFM SLLSREPDWQRALALLDW Sbjct: 74 YLDRSVDMEVLLAAIGQTQNEDELYAVMSPYNGRQLSMRFMVSLLSREPDWQRALALLDW 133 Query: 194 MNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSFGKQG 373 +NDKALY PSL AYNV+LRNVLRAKQ+HLAHGLFDEMR KGLSPDRYTYSTLIT FGK G Sbjct: 134 INDKALYRPSLFAYNVLLRNVLRAKQWHLAHGLFDEMRQKGLSPDRYTYSTLITCFGKHG 193 Query: 374 MFDS 385 +FDS Sbjct: 194 LFDS 197 >KYP57038.1 hypothetical protein KK1_003292 [Cajanus cajan] Length = 587 Score = 211 bits (538), Expect = 2e-63 Identities = 102/117 (87%), Positives = 111/117 (94%) Frame = +2 Query: 35 MEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDWMNDKALY 214 MEELL++IGQT NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQRALALLDW+NDKA Y Sbjct: 1 MEELLAAIGQTQNEDELYAVMSPYSARQLSIRFMVSLLSREPDWQRALALLDWINDKAHY 60 Query: 215 SPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSFGKQGMFDS 385 SPSL AYNVVLRNVLRAKQ+HLAHGLFDEMRHKGLSPDRYTYSTLITSFGK G+FDS Sbjct: 61 SPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITSFGKHGLFDS 117 >XP_018844776.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Juglans regia] Length = 687 Score = 210 bits (535), Expect = 3e-62 Identities = 96/128 (75%), Positives = 119/128 (92%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 QEP+++D SVDM+ELL+SIGQT NE+EL+++MSPY RQLS+RFM S+LSREPDWQR+LA Sbjct: 93 QEPVHLDHSVDMDELLTSIGQTQNEQELYSLMSPYKGRQLSIRFMVSMLSREPDWQRSLA 152 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+N++ALYSPS+ AYNVV+RNVLRAKQ+ +AHGLF+EMRH+ L+PDRYTYSTLIT F Sbjct: 153 LLDWINEEALYSPSVFAYNVVMRNVLRAKQWDIAHGLFEEMRHRALAPDRYTYSTLITYF 212 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 213 GKEGMFDS 220 >XP_004502213.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Cicer arietinum] Length = 669 Score = 206 bits (524), Expect = 1e-60 Identities = 98/127 (77%), Positives = 112/127 (88%) Frame = +2 Query: 5 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 184 +P Y+DR+V+M ELL+SIGQT N ++LHAVMSPYN LS+RFM SLLSREPDWQRALAL Sbjct: 72 QPTYLDRTVNMNELLTSIGQTQNVQQLHAVMSPYNGTNLSIRFMVSLLSREPDWQRALAL 131 Query: 185 LDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSFG 364 LDWMN+KA YSPS+ AYNVVLRNVLRAKQ+ AHGLFDEMR KG+SPD+YTYSTLIT FG Sbjct: 132 LDWMNEKARYSPSVSAYNVVLRNVLRAKQWLFAHGLFDEMRQKGISPDKYTYSTLITHFG 191 Query: 365 KQGMFDS 385 K G+FDS Sbjct: 192 KHGLFDS 198 >XP_016188467.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] XP_016188468.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] XP_016188469.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] Length = 661 Score = 204 bits (519), Expect = 5e-60 Identities = 96/128 (75%), Positives = 114/128 (89%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 ++ ++D +VDM+EL+SSI QT N EEL+A+MSPYN RQLS+RFM SLLSREPDWQR+LA Sbjct: 64 KDQTFLDHAVDMDELISSIRQTQNAEELYALMSPYNGRQLSMRFMVSLLSREPDWQRSLA 123 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+ND ALYSPS+ AYNVV+RNVLRAKQ+ +AHGLFDEMR +GL+PDRYTYSTLIT F Sbjct: 124 LLDWINDTALYSPSVFAYNVVIRNVLRAKQWQVAHGLFDEMRQRGLAPDRYTYSTLITQF 183 Query: 362 GKQGMFDS 385 GK GMFDS Sbjct: 184 GKNGMFDS 191 >XP_015953237.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953238.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953239.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953240.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] Length = 661 Score = 203 bits (516), Expect = 1e-59 Identities = 96/128 (75%), Positives = 113/128 (88%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 ++ ++D VDM+EL+SSI QT N EEL+A+MSPYN RQLS+RFM SLLSREPDWQR+LA Sbjct: 64 KDQTFLDHIVDMDELISSIRQTQNAEELYALMSPYNGRQLSMRFMVSLLSREPDWQRSLA 123 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+ND ALYSPS+ AYNVV+RNVLRAKQ+ +AHGLFDEMR +GL+PDRYTYSTLIT F Sbjct: 124 LLDWINDMALYSPSVFAYNVVIRNVLRAKQWQVAHGLFDEMRQRGLAPDRYTYSTLITQF 183 Query: 362 GKQGMFDS 385 GK GMFDS Sbjct: 184 GKNGMFDS 191 >OAY24567.1 hypothetical protein MANES_17G025500 [Manihot esculenta] Length = 667 Score = 201 bits (512), Expect = 6e-59 Identities = 95/128 (74%), Positives = 113/128 (88%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 +EP+Y+D S+DM+ELLSSI QT NE+EL++++SPY DRQLS+RFM SLLS E DW+R+LA Sbjct: 70 KEPVYLDHSLDMDELLSSISQTQNEQELYSLLSPYKDRQLSIRFMVSLLSHESDWERSLA 129 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+ND A YSPS+ AYNVVLRNVLRAKQ+ LAHGLFDEMR + L+PDRYTYSTLIT F Sbjct: 130 LLDWINDVARYSPSVFAYNVVLRNVLRAKQWELAHGLFDEMRKRALAPDRYTYSTLITYF 189 Query: 362 GKQGMFDS 385 GK GMFDS Sbjct: 190 GKAGMFDS 197 >XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Prunus mume] Length = 677 Score = 201 bits (512), Expect = 7e-59 Identities = 93/128 (72%), Positives = 115/128 (89%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q P ++D S+DM+ELLSSIGQT NE+EL+++MS Y RQLS+RFM SLLSREPDWQR+LA Sbjct: 83 QGPSHLDHSIDMDELLSSIGQTQNEQELYSLMSTYKGRQLSIRFMVSLLSREPDWQRSLA 142 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 +LDW+N++ALY+PS+ AYNVV+RNVLRAKQ+ +AHGLF+EMR + L+PDRYTYSTLITSF Sbjct: 143 ILDWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFEEMRQRALAPDRYTYSTLITSF 202 Query: 362 GKQGMFDS 385 GK GMFDS Sbjct: 203 GKAGMFDS 210 >XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Malus domestica] Length = 677 Score = 200 bits (509), Expect = 2e-58 Identities = 94/128 (73%), Positives = 114/128 (89%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q P ++D SVDM+ELLSSIGQT NE+EL+++MS Y RQLS+RFM SLLSRE DWQR+LA Sbjct: 83 QGPSHLDHSVDMDELLSSIGQTQNEQELYSLMSAYKGRQLSIRFMVSLLSRESDWQRSLA 142 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 +LDW+N++ALY+PS+ AYNVV+RNVLRAKQ+ +AHGLFDEMR + L+PDRYTYSTLITSF Sbjct: 143 ILDWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFDEMRQRALAPDRYTYSTLITSF 202 Query: 362 GKQGMFDS 385 GK GMFDS Sbjct: 203 GKAGMFDS 210 >XP_002276556.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vitis vinifera] CBI35026.3 unnamed protein product, partial [Vitis vinifera] Length = 675 Score = 199 bits (506), Expect = 5e-58 Identities = 93/128 (72%), Positives = 114/128 (89%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q +++D SVDM+ELL+SI QT NE+EL+++MSPY RQLS+RFM SLLSREPDWQR+LA Sbjct: 81 QRVVHLDHSVDMDELLASISQTSNEQELYSLMSPYKGRQLSIRFMVSLLSREPDWQRSLA 140 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW+N++A YSPS+ AYNVV+RNVLRAKQ+ LAHGLF+EMR + L+PDRYTYSTLIT F Sbjct: 141 LLDWINEEASYSPSVFAYNVVIRNVLRAKQWELAHGLFEEMRQRALAPDRYTYSTLITHF 200 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 201 GKEGMFDS 208 >XP_009125125.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Brassica rapa] Length = 675 Score = 199 bits (505), Expect = 7e-58 Identities = 94/128 (73%), Positives = 112/128 (87%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q ++D VDM+ELL+SI QTHNEEEL +++S Y DRQLS+RFM SLLSRE DWQR+LA Sbjct: 78 QRSTFLDHKVDMDELLASIHQTHNEEELFSLLSLYKDRQLSIRFMVSLLSREQDWQRSLA 137 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW++D+A Y+PS+ AYNVVLRNVLRAKQF +AHGLFDEMR + L+PDRYTYSTLITSF Sbjct: 138 LLDWVHDEAKYTPSVFAYNVVLRNVLRAKQFEIAHGLFDEMRQRALAPDRYTYSTLITSF 197 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 198 GKEGMFDS 205 >XP_003601624.1 PPR containing plant-like protein [Medicago truncatula] AES71875.1 PPR containing plant-like protein [Medicago truncatula] Length = 684 Score = 199 bits (505), Expect = 7e-58 Identities = 95/128 (74%), Positives = 111/128 (86%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q+ YMDRSVDM ELL+SI QT N E+L++++SPYN RQLS+RFM S+LSREPDWQR+LA Sbjct: 86 QQSPYMDRSVDMNELLTSIAQTQNIEQLYSILSPYNGRQLSIRFMISILSREPDWQRSLA 145 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 +LDWMN+ A YSPSL YNVV+RNVLRAKQ+ LAHGLFDEM KGLSPD+YTYSTLIT F Sbjct: 146 ILDWMNEIAQYSPSLNVYNVVIRNVLRAKQWQLAHGLFDEMLQKGLSPDKYTYSTLITHF 205 Query: 362 GKQGMFDS 385 KQG+FDS Sbjct: 206 SKQGLFDS 213 >XP_013647763.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Brassica napus] Length = 672 Score = 197 bits (502), Expect = 2e-57 Identities = 93/128 (72%), Positives = 112/128 (87%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q ++D VDM+ELL+SI QTHNEE+L +++S Y DRQLS+RFM SLLSRE DWQR+LA Sbjct: 75 QRSTFLDHKVDMDELLASIHQTHNEEDLFSLLSLYKDRQLSIRFMVSLLSREQDWQRSLA 134 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW++D+A Y+PS+ AYNVVLRNVLRAKQF +AHGLFDEMR + L+PDRYTYSTLITSF Sbjct: 135 LLDWVHDEAKYTPSVFAYNVVLRNVLRAKQFEIAHGLFDEMRQRALAPDRYTYSTLITSF 194 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 195 GKEGMFDS 202 >XP_013592391.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Brassica oleracea var. oleracea] XP_013719143.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Brassica napus] Length = 677 Score = 197 bits (502), Expect = 2e-57 Identities = 94/128 (73%), Positives = 112/128 (87%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q ++D VDM+ELL+SI QTHNEEEL +++S Y DRQLS+RFM SLLSRE DWQR+LA Sbjct: 80 QRSTFLDHKVDMDELLASIHQTHNEEELFSLLSLYKDRQLSIRFMVSLLSREQDWQRSLA 139 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 LLDW++D+A Y+PS+ AYNVVLRNVLRAKQF +AHGLFDEMR + L+PDRYTYSTLITSF Sbjct: 140 LLDWVHDEAKYTPSVFAYNVVLRNVLRAKQFDIAHGLFDEMRQRPLAPDRYTYSTLITSF 199 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 200 GKEGMFDS 207 >XP_015902775.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Ziziphus jujuba] Length = 683 Score = 197 bits (502), Expect = 2e-57 Identities = 91/128 (71%), Positives = 113/128 (88%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q P Y+D SVDM+ELL SIGQT NE EL++++SPY RQLS++FM SLLSRE DWQR+LA Sbjct: 89 QGPAYLDHSVDMDELLVSIGQTQNEHELYSLLSPYKGRQLSIKFMVSLLSRESDWQRSLA 148 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 +LDW+N++ALY+PS+ AYNVV+RNVLRAKQ+ +AHGLF+EMR + L+PDRYTYSTLIT F Sbjct: 149 ILDWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFEEMRQRALAPDRYTYSTLITYF 208 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 209 GKEGMFDS 216 >XP_015879457.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Ziziphus jujuba] Length = 683 Score = 197 bits (502), Expect = 2e-57 Identities = 91/128 (71%), Positives = 113/128 (88%) Frame = +2 Query: 2 QEPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALA 181 Q P Y+D SVDM+ELL SIGQT NE EL++++SPY RQLS++FM SLLSRE DWQR+LA Sbjct: 89 QGPAYLDHSVDMDELLVSIGQTQNEHELYSLLSPYKGRQLSIKFMVSLLSRESDWQRSLA 148 Query: 182 LLDWMNDKALYSPSLIAYNVVLRNVLRAKQFHLAHGLFDEMRHKGLSPDRYTYSTLITSF 361 +LDW+N++ALY+PS+ AYNVV+RNVLRAKQ+ +AHGLF+EMR + L+PDRYTYSTLIT F Sbjct: 149 ILDWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFEEMRQRALAPDRYTYSTLITYF 208 Query: 362 GKQGMFDS 385 GK+GMFDS Sbjct: 209 GKEGMFDS 216