BLASTX nr result
ID: Glycyrrhiza34_contig00017131
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017131 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH47955.1 hypothetical protein GLYMA_07G058600 [Glycine max] 62 6e-09 KYP53581.1 hypothetical protein KK1_024474 [Cajanus cajan] 62 6e-09 XP_003548527.1 PREDICTED: mediator of RNA polymerase II transcri... 62 8e-09 XP_003528804.1 PREDICTED: mediator of RNA polymerase II transcri... 62 9e-09 KYP53582.1 hypothetical protein KK1_024475 [Cajanus cajan] 61 1e-08 KHN27248.1 hypothetical protein glysoja_041806 [Glycine soja] 62 1e-08 XP_013444686.1 hypothetical protein MTR_8g028015 [Medicago trunc... 61 2e-08 XP_007135215.1 hypothetical protein PHAVU_010G110800g [Phaseolus... 61 2e-08 XP_017410234.1 PREDICTED: mediator of RNA polymerase II transcri... 61 2e-08 XP_004510745.2 PREDICTED: mediator of RNA polymerase II transcri... 60 2e-08 KOM29474.1 hypothetical protein LR48_Vigan707s000600 [Vigna angu... 61 2e-08 ACU21304.1 unknown, partial [Glycine max] 60 2e-08 XP_014515387.1 PREDICTED: mediator of RNA polymerase II transcri... 60 2e-08 XP_006581085.1 PREDICTED: mediator of RNA polymerase II transcri... 60 2e-08 XP_006581084.1 PREDICTED: mediator of RNA polymerase II transcri... 60 2e-08 XP_006581083.1 PREDICTED: mediator of RNA polymerase II transcri... 60 3e-08 KYP56335.1 hypothetical protein KK1_002573 [Cajanus cajan] 60 3e-08 XP_018860565.1 PREDICTED: mediator of RNA polymerase II transcri... 60 3e-08 XP_014632653.1 PREDICTED: mediator of RNA polymerase II transcri... 60 4e-08 XP_003526836.1 PREDICTED: mediator of RNA polymerase II transcri... 60 4e-08 >KRH47955.1 hypothetical protein GLYMA_07G058600 [Glycine max] Length = 191 Score = 61.6 bits (148), Expect = 6e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAP+DLPAAEKGIPT+AG Sbjct: 87 DLDVLKEAFQLRETAPIDLPAAEKGIPTIAG 117 >KYP53581.1 hypothetical protein KK1_024474 [Cajanus cajan] Length = 195 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LD DILKEAFQLKE AP+DLPAAEKGIPTVAG Sbjct: 86 LDFDILKEAFQLKENAPIDLPAAEKGIPTVAG 117 >XP_003548527.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a [Glycine max] XP_006598921.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a [Glycine max] XP_014624668.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a [Glycine max] KHN15961.1 hypothetical protein glysoja_013177 [Glycine soja] KRH06516.1 hypothetical protein GLYMA_16G027500 [Glycine max] KRH06517.1 hypothetical protein GLYMA_16G027500 [Glycine max] Length = 222 Score = 61.6 bits (148), Expect = 8e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAP+DLPAAEKGIPT+AG Sbjct: 86 DLDVLKEAFQLRETAPIDLPAAEKGIPTIAG 116 >XP_003528804.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a-like [Glycine max] KRH47954.1 hypothetical protein GLYMA_07G058600 [Glycine max] Length = 223 Score = 61.6 bits (148), Expect = 9e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAP+DLPAAEKGIPT+AG Sbjct: 87 DLDVLKEAFQLRETAPIDLPAAEKGIPTIAG 117 >KYP53582.1 hypothetical protein KK1_024475 [Cajanus cajan] Length = 218 Score = 61.2 bits (147), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKETAP+DLPAAEKGI TVAG Sbjct: 86 LDLDILKEAFQLKETAPIDLPAAEKGILTVAG 117 >KHN27248.1 hypothetical protein glysoja_041806 [Glycine soja] Length = 257 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAP+DLPAAEKGIPT+AG Sbjct: 87 DLDVLKEAFQLRETAPIDLPAAEKGIPTIAG 117 >XP_013444686.1 hypothetical protein MTR_8g028015 [Medicago truncatula] KEH18711.1 hypothetical protein MTR_8g028015 [Medicago truncatula] Length = 218 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLDILKE+FQL+ETAP+DLPAAEKGIPT+AG Sbjct: 87 DLDILKESFQLRETAPIDLPAAEKGIPTIAG 117 >XP_007135215.1 hypothetical protein PHAVU_010G110800g [Phaseolus vulgaris] ESW07209.1 hypothetical protein PHAVU_010G110800g [Phaseolus vulgaris] Length = 223 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAPVDLPAAEKGIPT++G Sbjct: 87 DLDVLKEAFQLRETAPVDLPAAEKGIPTISG 117 >XP_017410234.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a-like [Vigna angularis] BAT98057.1 hypothetical protein VIGAN_09167000 [Vigna angularis var. angularis] Length = 227 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAPVDLPAAEKGIPT++G Sbjct: 87 DLDVLKEAFQLRETAPVDLPAAEKGIPTISG 117 >XP_004510745.2 PREDICTED: mediator of RNA polymerase II transcription subunit 19a-like [Cicer arietinum] XP_012574149.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a-like [Cicer arietinum] Length = 203 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLDILKEAFQL+ET P+DLPAAEKGIPT+AG Sbjct: 87 DLDILKEAFQLRETTPIDLPAAEKGIPTIAG 117 >KOM29474.1 hypothetical protein LR48_Vigan707s000600 [Vigna angularis] Length = 237 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAPVDLPAAEKGIPT++G Sbjct: 97 DLDVLKEAFQLRETAPVDLPAAEKGIPTISG 127 >ACU21304.1 unknown, partial [Glycine max] Length = 174 Score = 59.7 bits (143), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 52 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 83 >XP_014515387.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a-like [Vigna radiata var. radiata] Length = 223 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKEAFQL+ETAP+DLPAAEKGIPT++G Sbjct: 87 DLDVLKEAFQLRETAPIDLPAAEKGIPTISG 117 >XP_006581085.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X5 [Glycine max] Length = 177 Score = 59.7 bits (143), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 49 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 80 >XP_006581084.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X4 [Glycine max] Length = 180 Score = 59.7 bits (143), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 52 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 83 >XP_006581083.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X3 [Glycine max] KRH51346.1 hypothetical protein GLYMA_06G001300 [Glycine max] Length = 186 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 58 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 89 >KYP56335.1 hypothetical protein KK1_002573 [Cajanus cajan] Length = 215 Score = 60.1 bits (144), Expect = 3e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLD+LKE FQL+ETAP+DLPAAEKGIPT+AG Sbjct: 87 DLDVLKETFQLRETAPIDLPAAEKGIPTIAG 117 >XP_018860565.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X2 [Juglans regia] Length = 202 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 371 DLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 DLDIL+EAFQL+ETAPVDLP AEKGIPTVAG Sbjct: 87 DLDILREAFQLRETAPVDLPLAEKGIPTVAG 117 >XP_014632653.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X2 [Glycine max] Length = 208 Score = 59.7 bits (143), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 80 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 111 >XP_003526836.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X1 [Glycine max] XP_006581082.1 PREDICTED: mediator of RNA polymerase II transcription subunit 19a isoform X1 [Glycine max] KHN19973.1 hypothetical protein glysoja_014551 [Glycine soja] KRH51343.1 hypothetical protein GLYMA_06G001300 [Glycine max] KRH51344.1 hypothetical protein GLYMA_06G001300 [Glycine max] KRH51345.1 hypothetical protein GLYMA_06G001300 [Glycine max] Length = 214 Score = 59.7 bits (143), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 374 LDLDILKEAFQLKETAPVDLPAAEKGIPTVAG 279 LDLDILKEAFQLKET P+DLPAAEKGI TVAG Sbjct: 86 LDLDILKEAFQLKETVPIDLPAAEKGILTVAG 117