BLASTX nr result
ID: Glycyrrhiza34_contig00017069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017069 (892 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015970378.1 PREDICTED: PAN domain-containing protein At5g0370... 67 8e-09 XP_016208101.1 PREDICTED: PAN domain-containing protein At5g0370... 65 4e-08 XP_015580493.1 PREDICTED: PAN domain-containing protein At5g0370... 64 1e-07 XP_019444287.1 PREDICTED: PAN domain-containing protein At5g0370... 64 1e-07 GAV90418.1 B_lectin domain-containing protein [Cephalotus follic... 60 1e-06 GAV80036.1 B_lectin domain-containing protein, partial [Cephalot... 60 2e-06 XP_015898694.1 PREDICTED: PAN domain-containing protein At5g0370... 58 6e-06 >XP_015970378.1 PREDICTED: PAN domain-containing protein At5g03700 [Arachis duranensis] Length = 496 Score = 67.0 bits (162), Expect = 8e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 815 MRWRRRKGVNGILKEENGASPGPYRNLGSASFRSIEMSVQ 696 MRWRR KGVNG+L EENG+SPGPYRNLGS SF+SIEMS Q Sbjct: 457 MRWRR-KGVNGMLGEENGSSPGPYRNLGSDSFKSIEMSGQ 495 >XP_016208101.1 PREDICTED: PAN domain-containing protein At5g03700 [Arachis ipaensis] Length = 492 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 815 MRWRRRKGVNGILKEENGASPGPYRNLGSASFRSIEMSVQ 696 MRWRR KGVNG+L EENG+SPGPYRNLG SF+SIEMS Q Sbjct: 453 MRWRR-KGVNGMLGEENGSSPGPYRNLGFDSFKSIEMSGQ 491 >XP_015580493.1 PREDICTED: PAN domain-containing protein At5g03700 [Ricinus communis] EEF33799.1 ATP binding protein, putative [Ricinus communis] Length = 491 Score = 63.5 bits (153), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 809 WRRRKGVNGILKEENGASPGPYRNLGSASFRSIEM 705 W+RR+GV GI +EENG SPGPY++LGSASFRSIEM Sbjct: 454 WKRRRGVKGIFEEENGVSPGPYKDLGSASFRSIEM 488 >XP_019444287.1 PREDICTED: PAN domain-containing protein At5g03700 [Lupinus angustifolius] OIW11327.1 hypothetical protein TanjilG_20476 [Lupinus angustifolius] Length = 493 Score = 63.5 bits (153), Expect = 1e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 815 MRWRRRKGVNGILKEENGASPGPYRNLGSASFRSIEM 705 MR +RRKGVNGILK+ENGAS GPY+NL S SFRSIEM Sbjct: 453 MRLKRRKGVNGILKDENGASSGPYKNLESTSFRSIEM 489 >GAV90418.1 B_lectin domain-containing protein [Cephalotus follicularis] Length = 504 Score = 60.1 bits (144), Expect = 1e-06 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -3 Query: 809 WRRRKGVNGILKEENGASPGPYRNLGSASFRSIEMSV 699 WRR++GVNG L+E+ GASPGPY++LGSASF+SIE+ + Sbjct: 464 WRRQRGVNGFLEEDCGASPGPYKDLGSASFKSIEIEM 500 >GAV80036.1 B_lectin domain-containing protein, partial [Cephalotus follicularis] Length = 494 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 809 WRRRKGVNGILKEENGASPGPYRNLGSASFRSIEM 705 WRR++GVNG L+E+ GASPGPY++LGSASF+SIE+ Sbjct: 460 WRRQRGVNGFLEEDCGASPGPYKDLGSASFKSIEI 494 >XP_015898694.1 PREDICTED: PAN domain-containing protein At5g03700 [Ziziphus jujuba] Length = 507 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 809 WRRRKGVNGILKEENGASPGPYRNLGSASFRSIEM 705 W+RR+GV L+EE G SPGPYR+LGSASF+SIEM Sbjct: 470 WKRRRGVKRFLEEEGGVSPGPYRDLGSASFKSIEM 504