BLASTX nr result
ID: Glycyrrhiza34_contig00017019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017019 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW56103.1 hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] 57 3e-08 >KCW56103.1 hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 57.4 bits (137), Expect = 3e-08 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 18/100 (18%) Frame = -2 Query: 264 VRDKGGSH*MEG-FARSNARLVDSEWSA*APLD*REGRVLH*LVSQVRNE---RRRATSS 97 +R++GG+ ++ ARSNA L DSEWSA APL+ G VLH LVSQVRNE + RATS+ Sbjct: 1 MRERGGATKLKASLARSNAHLGDSEWSAEAPLE--IGGVLHELVSQVRNEPCLQSRATSA 58 Query: 96 CXXXXXXXXXXXLH--------------FIGALAKPYKGK 19 C H +IGA+AKP + K Sbjct: 59 CLLLAKLLELDNKHSSIVKRLLIRPTTTYIGAIAKPSRIK 98