BLASTX nr result
ID: Glycyrrhiza34_contig00016026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00016026 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK24645.1 PgDwarf8, partial [Cenchrus americanus] 54 3e-06 XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipa... 54 3e-06 XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis dur... 54 3e-06 XP_003531153.1 PREDICTED: DELLA protein GAI1-like [Glycine max] ... 52 1e-05 XP_009380281.1 PREDICTED: DELLA protein SLN1-like [Musa acuminat... 52 1e-05 AGK07287.1 GAI1 [Rosa hybrid cultivar] 52 1e-05 >AFK24645.1 PgDwarf8, partial [Cenchrus americanus] Length = 407 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFELHRLL HPGAL+KV+ VR +RP+IVTVV Sbjct: 324 VFELHRLLAHPGALEKVLGTVRAVRPRIVTVV 355 >XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipaensis] Length = 603 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFELH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 433 VFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis duranensis] Length = 603 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFELH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 433 VFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >XP_003531153.1 PREDICTED: DELLA protein GAI1-like [Glycine max] KRH42544.1 hypothetical protein GLYMA_08G095800 [Glycine max] Length = 517 Score = 52.0 bits (123), Expect = 1e-05 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFE H+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 350 VFEFHKLLARPGAVEKVLSVVRQIRPEIVTVV 381 >XP_009380281.1 PREDICTED: DELLA protein SLN1-like [Musa acuminata subsp. malaccensis] Length = 595 Score = 52.0 bits (123), Expect = 1e-05 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFELHRLL PGALDKV+ VR +RP+IVTVV Sbjct: 412 VFELHRLLARPGALDKVLGTVRAVRPRIVTVV 443 >AGK07287.1 GAI1 [Rosa hybrid cultivar] Length = 618 Score = 52.0 bits (123), Expect = 1e-05 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -2 Query: 270 VFELHRLLIHPGALDKVISVVRQIRPKIVTVV 175 VFELH+LL PGA+DKV+SVV+Q++P+IVTVV Sbjct: 448 VFELHKLLARPGAIDKVLSVVKQMKPEIVTVV 479