BLASTX nr result
ID: Glycyrrhiza34_contig00015471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00015471 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012078668.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 61 9e-09 XP_012078667.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 61 9e-09 XP_012078666.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 61 9e-09 KDP32315.1 hypothetical protein JCGZ_13240 [Jatropha curcas] 61 1e-08 KOM54292.1 hypothetical protein LR48_Vigan10g018400 [Vigna angul... 61 1e-08 GAU41531.1 hypothetical protein TSUD_140620 [Trifolium subterran... 60 2e-08 XP_010088865.1 Nudix hydrolase 20 [Morus notabilis] EXB37062.1 N... 60 2e-08 EEF47027.1 Nudix hydrolase 20, chloroplast precursor, putative [... 60 2e-08 XP_008242161.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 60 2e-08 XP_009352490.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 60 3e-08 XP_009352489.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 60 3e-08 XP_004512948.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 59 8e-08 XP_017438849.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 59 8e-08 XP_014515962.1 PREDICTED: nudix hydrolase 20, chloroplastic-like... 59 8e-08 XP_007152800.1 hypothetical protein PHAVU_004G160700g [Phaseolus... 59 8e-08 XP_007204366.1 hypothetical protein PRUPE_ppa007288mg [Prunus pe... 59 8e-08 OAY26742.1 hypothetical protein MANES_16G071100 [Manihot esculen... 59 8e-08 BAU02826.1 hypothetical protein VIGAN_11241500 [Vigna angularis ... 59 8e-08 KVI11627.1 NUDIX hydrolase domain-containing protein [Cynara car... 59 8e-08 ONH97376.1 hypothetical protein PRUPE_7G186600 [Prunus persica] 59 8e-08 >XP_012078668.1 PREDICTED: nudix hydrolase 20, chloroplastic-like isoform X3 [Jatropha curcas] Length = 363 Score = 61.2 bits (147), Expect = 9e-09 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDIEGYRYK DVLFCYDL LP SF Sbjct: 263 AIPVGAVSYMDIEGYRYKRDVLFCYDLKLPESF 295 >XP_012078667.1 PREDICTED: nudix hydrolase 20, chloroplastic-like isoform X2 [Jatropha curcas] Length = 389 Score = 61.2 bits (147), Expect = 9e-09 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDIEGYRYK DVLFCYDL LP SF Sbjct: 289 AIPVGAVSYMDIEGYRYKRDVLFCYDLKLPESF 321 >XP_012078666.1 PREDICTED: nudix hydrolase 20, chloroplastic-like isoform X1 [Jatropha curcas] Length = 389 Score = 61.2 bits (147), Expect = 9e-09 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDIEGYRYK DVLFCYDL LP SF Sbjct: 289 AIPVGAVSYMDIEGYRYKRDVLFCYDLKLPESF 321 >KDP32315.1 hypothetical protein JCGZ_13240 [Jatropha curcas] Length = 458 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDIEGYRYK DVLFCYDL LP SF Sbjct: 358 AIPVGAVSYMDIEGYRYKRDVLFCYDLKLPESF 390 >KOM54292.1 hypothetical protein LR48_Vigan10g018400 [Vigna angularis] Length = 341 Score = 60.8 bits (146), Expect = 1e-08 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 5/60 (8%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF-----EAYANLENLICMRELTDDIHNN 201 AIPV AVSYMDI+GYRYK DVLFCYDL LP F + + LI +R++ + IH + Sbjct: 269 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPKDFIPNNEDGEVDSFKLIPVRQVAEVIHTS 328 >GAU41531.1 hypothetical protein TSUD_140620 [Trifolium subterraneum] Length = 267 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 A PV AVSYMDI+GYRYK DVLFCYDLILP SF Sbjct: 186 AKPVGAVSYMDIDGYRYKRDVLFCYDLILPESF 218 >XP_010088865.1 Nudix hydrolase 20 [Morus notabilis] EXB37062.1 Nudix hydrolase 20 [Morus notabilis] Length = 379 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 40 IPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 IPV A+SYMDI+GYRYK DVLFCYDL LP+SF Sbjct: 280 IPVGAISYMDIDGYRYKRDVLFCYDLKLPVSF 311 >EEF47027.1 Nudix hydrolase 20, chloroplast precursor, putative [Ricinus communis] Length = 329 Score = 60.1 bits (144), Expect = 2e-08 Identities = 32/48 (66%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF--EAYANLENLICMR 174 AIPV AVSYMDIE YRYK DVLFCYDL LP F + NLE L+ R Sbjct: 271 AIPVGAVSYMDIEEYRYKRDVLFCYDLKLPDGFIPKNQGNLEALLAFR 318 >XP_008242161.1 PREDICTED: nudix hydrolase 20, chloroplastic-like [Prunus mume] Length = 370 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYRYK DVLFCYDL LP SF Sbjct: 270 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPESF 302 >XP_009352490.1 PREDICTED: nudix hydrolase 20, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 373 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 A+PV AVSYMDI+GYRYK DVLFCYDL LP SF Sbjct: 278 AVPVGAVSYMDIDGYRYKRDVLFCYDLKLPESF 310 >XP_009352489.1 PREDICTED: nudix hydrolase 20, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 378 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 A+PV AVSYMDI+GYRYK DVLFCYDL LP SF Sbjct: 278 AVPVGAVSYMDIDGYRYKRDVLFCYDLKLPESF 310 >XP_004512948.1 PREDICTED: nudix hydrolase 20, chloroplastic-like [Cicer arietinum] Length = 352 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 A PV VSYMDI+GYRYK DVLFCYDLILP SF Sbjct: 252 AKPVGVVSYMDIDGYRYKRDVLFCYDLILPQSF 284 >XP_017438849.1 PREDICTED: nudix hydrolase 20, chloroplastic-like [Vigna angularis] Length = 369 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYRYK DVLFCYDL LP F Sbjct: 269 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPKDF 301 >XP_014515962.1 PREDICTED: nudix hydrolase 20, chloroplastic-like [Vigna radiata var. radiata] Length = 369 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYRYK DVLFCYDL LP F Sbjct: 269 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPKDF 301 >XP_007152800.1 hypothetical protein PHAVU_004G160700g [Phaseolus vulgaris] ESW24794.1 hypothetical protein PHAVU_004G160700g [Phaseolus vulgaris] Length = 369 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYRYK DVLFCYDL LP F Sbjct: 269 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPKDF 301 >XP_007204366.1 hypothetical protein PRUPE_ppa007288mg [Prunus persica] Length = 374 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYR+K DVLFCYDL LP SF Sbjct: 274 AIPVGAVSYMDIDGYRFKRDVLFCYDLKLPESF 306 >OAY26742.1 hypothetical protein MANES_16G071100 [Manihot esculenta] OAY26743.1 hypothetical protein MANES_16G071100 [Manihot esculenta] Length = 376 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 A+PV AVSY DIEGYRYK DVLFCYDL LP SF Sbjct: 276 AVPVGAVSYADIEGYRYKRDVLFCYDLKLPDSF 308 >BAU02826.1 hypothetical protein VIGAN_11241500 [Vigna angularis var. angularis] Length = 387 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYRYK DVLFCYDL LP F Sbjct: 287 AIPVGAVSYMDIDGYRYKRDVLFCYDLKLPKDF 319 >KVI11627.1 NUDIX hydrolase domain-containing protein [Cynara cardunculus var. scolymus] Length = 401 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYR+K DVLFCYDL LP SF Sbjct: 301 AIPVGAVSYMDIDGYRFKRDVLFCYDLKLPESF 333 >ONH97376.1 hypothetical protein PRUPE_7G186600 [Prunus persica] Length = 404 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 37 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 135 AIPV AVSYMDI+GYR+K DVLFCYDL LP SF Sbjct: 304 AIPVGAVSYMDIDGYRFKRDVLFCYDLKLPESF 336