BLASTX nr result
ID: Glycyrrhiza34_contig00015145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00015145 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU16167.1 unknown, partial [Glycine max] 62 6e-10 >ACU16167.1 unknown, partial [Glycine max] Length = 105 Score = 61.6 bits (148), Expect = 6e-10 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 162 SSEGLLTKYYHRRLHNVKETTTVHVSRGHHQGNLSGHGLHQRY 290 S++ + T++YH LHN K TT HVSRGHH GNL+GHGLHQR+ Sbjct: 50 STKPMSTQHYHYELHN-KMNTTTHVSRGHHHGNLNGHGLHQRH 91