BLASTX nr result
ID: Glycyrrhiza34_contig00014461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00014461 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016198279.1 PREDICTED: probable prefoldin subunit 3 [Arachis ... 114 8e-30 XP_018847228.1 PREDICTED: probable prefoldin subunit 3 [Juglans ... 114 9e-30 XP_010106708.1 putative prefoldin subunit 3 [Morus notabilis] EX... 113 2e-29 XP_015936910.1 PREDICTED: probable prefoldin subunit 3 [Arachis ... 112 5e-29 XP_015883174.1 PREDICTED: probable prefoldin subunit 3 [Ziziphus... 112 7e-29 XP_014635023.1 PREDICTED: uncharacterized protein LOC100305759 i... 110 7e-29 GAV71698.1 Prefoldin domain-containing protein [Cephalotus folli... 111 1e-28 XP_010056707.1 PREDICTED: probable prefoldin subunit 3 [Eucalypt... 111 1e-28 NP_001236305.1 uncharacterized protein LOC100305759 [Glycine max... 110 2e-28 XP_008223382.1 PREDICTED: probable prefoldin subunit 3 [Prunus m... 110 2e-28 XP_011010679.1 PREDICTED: probable prefoldin subunit 3 [Populus ... 110 2e-28 KJB12680.1 hypothetical protein B456_002G030800 [Gossypium raimo... 110 2e-28 KYP62508.1 putative prefoldin subunit 3 [Cajanus cajan] 110 2e-28 KHN12858.1 Putative prefoldin subunit 3 [Glycine soja] 110 2e-28 NP_001238200.1 uncharacterized protein LOC100527836 [Glycine max... 110 2e-28 XP_007035840.1 PREDICTED: probable prefoldin subunit 3 [Theobrom... 110 3e-28 OMO58475.1 Prefoldin subunit [Corchorus olitorius] 110 3e-28 OMO53483.1 Prefoldin subunit [Corchorus capsularis] 110 3e-28 XP_012453363.1 PREDICTED: probable prefoldin subunit 3 [Gossypiu... 110 3e-28 XP_017638814.1 PREDICTED: probable prefoldin subunit 3 [Gossypiu... 110 3e-28 >XP_016198279.1 PREDICTED: probable prefoldin subunit 3 [Arachis ipaensis] Length = 191 Score = 114 bits (285), Expect = 8e-30 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 14 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 71 >XP_018847228.1 PREDICTED: probable prefoldin subunit 3 [Juglans regia] Length = 192 Score = 114 bits (285), Expect = 9e-30 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 16 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 73 >XP_010106708.1 putative prefoldin subunit 3 [Morus notabilis] EXC11392.1 putative prefoldin subunit 3 [Morus notabilis] Length = 191 Score = 113 bits (282), Expect = 2e-29 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 14 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 71 >XP_015936910.1 PREDICTED: probable prefoldin subunit 3 [Arachis duranensis] Length = 191 Score = 112 bits (280), Expect = 5e-29 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYL QSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 14 ERRGIPGAQFVEDVQTYLNQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 71 >XP_015883174.1 PREDICTED: probable prefoldin subunit 3 [Ziziphus jujuba] XP_015867161.1 PREDICTED: probable prefoldin subunit 3 [Ziziphus jujuba] Length = 192 Score = 112 bits (279), Expect = 7e-29 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYL QSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 15 ERRGIPGAQFVEDVQTYLDQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 72 >XP_014635023.1 PREDICTED: uncharacterized protein LOC100305759 isoform X1 [Glycine max] Length = 155 Score = 110 bits (276), Expect = 7e-29 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDV SALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 12 ERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 69 >GAV71698.1 Prefoldin domain-containing protein [Cephalotus follicularis] Length = 190 Score = 111 bits (277), Expect = 1e-28 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQ+YL+QSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 11 ERRGIPGAQFVEDVQSYLSQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 68 >XP_010056707.1 PREDICTED: probable prefoldin subunit 3 [Eucalyptus grandis] KCW73500.1 hypothetical protein EUGRSUZ_E02007 [Eucalyptus grandis] Length = 190 Score = 111 bits (277), Expect = 1e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYL Q+GLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 13 ERRGIPGAQFVEDVQTYLAQAGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 70 >NP_001236305.1 uncharacterized protein LOC100305759 [Glycine max] ACU13615.1 unknown [Glycine max] KRH36957.1 hypothetical protein GLYMA_09G034400 [Glycine max] Length = 189 Score = 110 bits (276), Expect = 2e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDV SALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 12 ERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 69 >XP_008223382.1 PREDICTED: probable prefoldin subunit 3 [Prunus mume] Length = 190 Score = 110 bits (276), Expect = 2e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQ+GLDVNSALAFLQERLQQYKLVEMKL AQQRDLQAKIP Sbjct: 15 ERRGIPGAQFVEDVQTYLTQAGLDVNSALAFLQERLQQYKLVEMKLQAQQRDLQAKIP 72 >XP_011010679.1 PREDICTED: probable prefoldin subunit 3 [Populus euphratica] Length = 191 Score = 110 bits (276), Expect = 2e-28 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYLTQSGLDVNS+L+FLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 14 ERRGIPGAQFVEDVETYLTQSGLDVNSSLSFLQERLQQYKLVEMKLLAQQRDLQAKIP 71 >KJB12680.1 hypothetical protein B456_002G030800 [Gossypium raimondii] Length = 179 Score = 110 bits (275), Expect = 2e-28 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYLTQ+G DVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 17 ERRGIPGAQFVEDVETYLTQTGFDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 74 >KYP62508.1 putative prefoldin subunit 3 [Cajanus cajan] Length = 195 Score = 110 bits (276), Expect = 2e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDV SALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 18 ERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 75 >KHN12858.1 Putative prefoldin subunit 3 [Glycine soja] Length = 195 Score = 110 bits (276), Expect = 2e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDV SALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 18 ERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 75 >NP_001238200.1 uncharacterized protein LOC100527836 [Glycine max] ACU17027.1 unknown [Glycine max] KHN24858.1 Putative prefoldin subunit 3 [Glycine soja] KRH11921.1 hypothetical protein GLYMA_15G139100 [Glycine max] Length = 195 Score = 110 bits (276), Expect = 2e-28 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDVQTYLTQSGLDV SALAFLQERLQQYK+VEMKLLAQQRDLQAKIP Sbjct: 18 ERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIP 75 >XP_007035840.1 PREDICTED: probable prefoldin subunit 3 [Theobroma cacao] EOY06766.1 Prefoldin 3 [Theobroma cacao] Length = 193 Score = 110 bits (275), Expect = 3e-28 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYL+Q+GLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 16 ERRGIPGAQFVEDVETYLSQAGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 73 >OMO58475.1 Prefoldin subunit [Corchorus olitorius] Length = 195 Score = 110 bits (275), Expect = 3e-28 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYL+Q+GLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 16 ERRGIPGAQFVEDVETYLSQTGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 73 >OMO53483.1 Prefoldin subunit [Corchorus capsularis] Length = 195 Score = 110 bits (275), Expect = 3e-28 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYL+Q+GLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 16 ERRGIPGAQFVEDVETYLSQTGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 73 >XP_012453363.1 PREDICTED: probable prefoldin subunit 3 [Gossypium raimondii] XP_016724309.1 PREDICTED: probable prefoldin subunit 3 [Gossypium hirsutum] KJB12679.1 hypothetical protein B456_002G030800 [Gossypium raimondii] KJB12681.1 hypothetical protein B456_002G030800 [Gossypium raimondii] Length = 196 Score = 110 bits (275), Expect = 3e-28 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYLTQ+G DVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 17 ERRGIPGAQFVEDVETYLTQTGFDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 74 >XP_017638814.1 PREDICTED: probable prefoldin subunit 3 [Gossypium arboreum] XP_017638815.1 PREDICTED: probable prefoldin subunit 3 [Gossypium arboreum] KHG11253.1 hypothetical protein F383_01255 [Gossypium arboreum] Length = 196 Score = 110 bits (275), Expect = 3e-28 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +1 Query: 157 ERRGIPGAQFVEDVQTYLTQSGLDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 330 ERRGIPGAQFVEDV+TYLTQ+G DVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP Sbjct: 17 ERRGIPGAQFVEDVETYLTQTGFDVNSALAFLQERLQQYKLVEMKLLAQQRDLQAKIP 74