BLASTX nr result
ID: Glycyrrhiza34_contig00014437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00014437 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001242405.1 phytoene synthase, chloroplastic-like [Glycine ma... 120 9e-31 XP_015931720.1 PREDICTED: phytoene synthase 2, chloroplastic [Ar... 120 1e-30 KHN41025.1 Phytoene synthase, chloroplastic [Glycine soja] 120 1e-30 XP_006574393.1 PREDICTED: uncharacterized protein LOC100780932 i... 120 1e-30 XP_016166294.1 PREDICTED: phytoene synthase 2, chloroplastic [Ar... 119 4e-30 KRH17267.1 hypothetical protein GLYMA_14G209700 [Glycine max] 116 3e-29 KHN39504.1 Phytoene synthase, chloroplastic [Glycine soja] 116 3e-29 KYP48364.1 hypothetical protein KK1_029976 [Cajanus cajan] 115 1e-28 XP_019432581.1 PREDICTED: phytoene synthase 2, chloroplastic-lik... 114 2e-28 XP_012568501.1 PREDICTED: phytoene synthase 2, chloroplastic [Ci... 114 3e-28 XP_014504995.1 PREDICTED: phytoene synthase 2, chloroplastic [Vi... 113 5e-28 XP_019460948.1 PREDICTED: phytoene synthase 2, chloroplastic-lik... 112 1e-27 XP_017430735.1 PREDICTED: phytoene synthase 2, chloroplastic [Vi... 110 4e-27 XP_003616147.1 squalene/phytoene synthase [Medicago truncatula] ... 110 7e-27 XP_007141971.1 hypothetical protein PHAVU_008G241500g [Phaseolus... 109 1e-26 AFK91527.1 phytoene synthase, partial [Beta vulgaris] 101 2e-26 AET07434.1 phytoene synthase, partial [Ipomoea batatas] 100 6e-26 ACY42670.1 phytoene synthase 2 [Manihot esculenta] 104 7e-25 ACY42669.1 phytoene synthase 2 [Manihot esculenta] 104 7e-25 ACY42665.1 phytoene synthase 2 [Manihot esculenta] ACY42667.1 ph... 104 7e-25 >NP_001242405.1 phytoene synthase, chloroplastic-like [Glycine max] ACU17983.1 unknown [Glycine max] Length = 399 Score = 120 bits (300), Expect = 9e-31 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPVMK Sbjct: 339 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPVMK 398 >XP_015931720.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931721.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931722.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931723.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] Length = 437 Score = 120 bits (301), Expect = 1e-30 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKL SLP AYARS+VPPSRKLSPVMK Sbjct: 377 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLFSLPTAYARSMVPPSRKLSPVMK 436 Query: 183 A 185 A Sbjct: 437 A 437 >KHN41025.1 Phytoene synthase, chloroplastic [Glycine soja] Length = 436 Score = 120 bits (300), Expect = 1e-30 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPVMK Sbjct: 376 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPVMK 435 >XP_006574393.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574394.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574395.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574396.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] KRH72908.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72909.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72910.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72911.1 hypothetical protein GLYMA_02G240200 [Glycine max] Length = 436 Score = 120 bits (300), Expect = 1e-30 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPVMK Sbjct: 376 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPVMK 435 >XP_016166294.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166295.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166296.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166298.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] Length = 437 Score = 119 bits (297), Expect = 4e-30 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKL SLP AYARS+VPPSRKLSP MK Sbjct: 377 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLFSLPTAYARSMVPPSRKLSPAMK 436 Query: 183 A 185 A Sbjct: 437 A 437 >KRH17267.1 hypothetical protein GLYMA_14G209700 [Glycine max] Length = 433 Score = 116 bits (291), Expect = 3e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLPAAYARS+VPPS+KLS VMK Sbjct: 373 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPAAYARSMVPPSKKLSSVMK 432 >KHN39504.1 Phytoene synthase, chloroplastic [Glycine soja] Length = 436 Score = 116 bits (291), Expect = 3e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLPAAYARS+VPPS+KLS VMK Sbjct: 376 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPAAYARSMVPPSKKLSSVMK 435 >KYP48364.1 hypothetical protein KK1_029976 [Cajanus cajan] Length = 449 Score = 115 bits (287), Expect = 1e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLP AYARS+VPPSRKLS +MK Sbjct: 389 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPNAYARSMVPPSRKLSSIMK 448 >XP_019432581.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019432587.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] OIW16120.1 hypothetical protein TanjilG_18835 [Lupinus angustifolius] Length = 436 Score = 114 bits (285), Expect = 2e-28 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFTKRAYV KAKKLLSLP AYARS+V PSRK+SP MK Sbjct: 376 WPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLSLPIAYARSMVSPSRKVSPAMK 435 Query: 183 A 185 A Sbjct: 436 A 436 >XP_012568501.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] XP_012568502.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] XP_012568503.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] Length = 436 Score = 114 bits (284), Expect = 3e-28 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYN FTKRAYVSKAKKLLSLP AYARS+VPPSRKL VMK Sbjct: 376 WPVWASLLLYRQILDEIEANDYNTFTKRAYVSKAKKLLSLPMAYARSMVPPSRKLPHVMK 435 Query: 183 A 185 A Sbjct: 436 A 436 >XP_014504995.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] XP_014504996.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] XP_014504997.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] Length = 435 Score = 113 bits (282), Expect = 5e-28 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLP A+ARSVVPPS+ LSPVMK Sbjct: 375 WPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPVAFARSVVPPSKILSPVMK 434 >XP_019460948.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460949.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460950.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460951.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] OIW02629.1 hypothetical protein TanjilG_24080 [Lupinus angustifolius] Length = 432 Score = 112 bits (280), Expect = 1e-27 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFTKRAYV KAKKLLSLP AYARS+VPP RK+S MK Sbjct: 372 WPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLSLPIAYARSMVPPPRKVSSAMK 431 Query: 183 A 185 A Sbjct: 432 A 432 >XP_017430735.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430736.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430737.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430738.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] KOM47099.1 hypothetical protein LR48_Vigan07g080300 [Vigna angularis] BAT81313.1 hypothetical protein VIGAN_03100300 [Vigna angularis var. angularis] Length = 435 Score = 110 bits (276), Expect = 4e-27 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYV KAKK LSLP A+ARS+VPPS+ LSPVMK Sbjct: 375 WPVWASLLLYRQILDEIEANDYNNFTRRAYVGKAKKFLSLPVAFARSMVPPSKVLSPVMK 434 >XP_003616147.1 squalene/phytoene synthase [Medicago truncatula] AES99105.1 squalene/phytoene synthase [Medicago truncatula] Length = 434 Score = 110 bits (274), Expect = 7e-27 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 176 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSK KKLLSLP AYARS+VPPS+KLS V Sbjct: 377 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKTKKLLSLPLAYARSMVPPSKKLSHV 434 >XP_007141971.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] XP_007141972.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] ESW13965.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] ESW13966.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] Length = 435 Score = 109 bits (273), Expect = 1e-26 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYRQILDEIEANDYNNFT+RAYV K KK LSLP A+ARS+VPPS+ LSPVMK Sbjct: 375 WPVWASLLLYRQILDEIEANDYNNFTRRAYVGKTKKFLSLPVAFARSMVPPSKVLSPVMK 434 Query: 183 A 185 + Sbjct: 435 S 435 >AFK91527.1 phytoene synthase, partial [Beta vulgaris] Length = 107 Score = 101 bits (252), Expect = 2e-26 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPP 155 WPVWASLLLYRQILDEIE NDYNNFTKRAYV KAKKLLSLP AYARSVVPP Sbjct: 48 WPVWASLLLYRQILDEIEVNDYNNFTKRAYVGKAKKLLSLPIAYARSVVPP 98 >AET07434.1 phytoene synthase, partial [Ipomoea batatas] Length = 117 Score = 100 bits (250), Expect = 6e-26 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYR+ILDEIEANDYNNFT+RAYVSK KKLL+LP AYA++V+ PS SP+ K Sbjct: 57 WPVWASLLLYRKILDEIEANDYNNFTRRAYVSKPKKLLALPIAYAKAVIRPSTTASPLAK 116 Query: 183 A 185 A Sbjct: 117 A 117 >ACY42670.1 phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 104 bits (260), Expect = 7e-25 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV K Sbjct: 369 WPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPVTK 428 Query: 183 A 185 A Sbjct: 429 A 429 >ACY42669.1 phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 104 bits (260), Expect = 7e-25 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV K Sbjct: 369 WPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPVTK 428 Query: 183 A 185 A Sbjct: 429 A 429 >ACY42665.1 phytoene synthase 2 [Manihot esculenta] ACY42667.1 phytoene synthase 2 [Manihot esculenta] ACY42668.1 phytoene synthase 2 [Manihot esculenta] OAY60593.1 hypothetical protein MANES_01G124200 [Manihot esculenta] Length = 429 Score = 104 bits (260), Expect = 7e-25 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = +3 Query: 3 WPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPVMK 182 WPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV K Sbjct: 369 WPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPVTK 428 Query: 183 A 185 A Sbjct: 429 A 429