BLASTX nr result
ID: Glycyrrhiza34_contig00014035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00014035 (572 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU50408.1 hypothetical protein TSUD_244550 [Trifolium subterran... 69 1e-10 GAU46403.1 hypothetical protein TSUD_28190 [Trifolium subterraneum] 63 5e-09 XP_003614894.1 DUF223 domain protein [Medicago truncatula] AES97... 60 1e-08 XP_013446984.1 animal RPA1 domain protein [Medicago truncatula] ... 60 5e-08 XP_003599362.1 DUF223 domain protein [Medicago truncatula] AES69... 59 5e-08 XP_007146146.1 hypothetical protein PHAVU_006G016100g [Phaseolus... 62 7e-08 XP_013445527.1 animal RPA1 domain protein [Medicago truncatula] ... 60 2e-07 XP_007161930.1 hypothetical protein PHAVU_001G109800g [Phaseolus... 60 2e-07 XP_007134592.1 hypothetical protein PHAVU_010G0596000g, partial ... 57 2e-07 XP_013445015.1 animal RPA1 domain protein [Medicago truncatula] ... 58 3e-07 XP_013441177.1 animal RPA1 domain protein, partial [Medicago tru... 57 3e-07 XP_003613114.1 PIF1 DNA helicase/replication A1-like protein, pu... 56 4e-07 XP_003595510.1 replication factor-A carboxy-terminal domain prot... 59 5e-07 XP_003602586.2 animal RPA1 domain protein [Medicago truncatula] ... 57 7e-07 XP_003625314.2 animal RPA1 domain protein [Medicago truncatula] ... 57 7e-07 XP_013451975.1 animal RPA1 domain protein [Medicago truncatula] ... 58 8e-07 XP_013469460.1 animal RPA1 domain protein [Medicago truncatula] ... 58 9e-07 XP_003629969.2 DUF223 domain protein [Medicago truncatula] AET04... 58 9e-07 XP_007144285.1 hypothetical protein PHAVU_007G143500g [Phaseolus... 58 1e-06 XP_003603933.2 animal RPA1 domain protein [Medicago truncatula] ... 56 1e-06 >GAU50408.1 hypothetical protein TSUD_244550 [Trifolium subterraneum] Length = 340 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -2 Query: 433 PRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 P+HD++S I+PAKE W +I RV+ LW+V D ++ KLPFSMEMVL D K Sbjct: 3 PKHDAISEISPAKENWNLIVRVVRLWYVKDMARDKLPFSMEMVLMDSK 50 >GAU46403.1 hypothetical protein TSUD_28190 [Trifolium subterraneum] Length = 197 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -2 Query: 433 PRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 P+HD++S I+ AKE W +I RV+ LW+V D + KLPFSMEM+L D K Sbjct: 3 PKHDAISEISLAKENWNLIVRVVRLWYVKDMIRDKLPFSMEMMLMDSK 50 >XP_003614894.1 DUF223 domain protein [Medicago truncatula] AES97852.1 DUF223 domain protein [Medicago truncatula] Length = 109 Score = 60.5 bits (145), Expect = 1e-08 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +HD +S ++P K+ WT++ RV+ WF D+ +KLPFSME VL D K Sbjct: 3 ISTKHDFISDVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLMDQK 52 >XP_013446984.1 animal RPA1 domain protein [Medicago truncatula] XP_013466834.1 animal RPA1 domain protein [Medicago truncatula] KEH21011.1 animal RPA1 domain protein [Medicago truncatula] KEH40875.1 animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 60.1 bits (144), Expect = 5e-08 Identities = 23/50 (46%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +HD +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHDFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_003599362.1 DUF223 domain protein [Medicago truncatula] AES69613.1 DUF223 domain protein [Medicago truncatula] Length = 107 Score = 58.5 bits (140), Expect = 5e-08 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +HD +S ++P K+ WT++ RV+ WF D+ +KLPFSME VL D K Sbjct: 1 MSTKHDFISDVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLIDQK 50 >XP_007146146.1 hypothetical protein PHAVU_006G016100g [Phaseolus vulgaris] ESW18140.1 hypothetical protein PHAVU_006G016100g [Phaseolus vulgaris] Length = 425 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -2 Query: 436 NPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQD 296 N RH SV +T AKE W I+ RV+ LWFVTD +K K+PFS+E++LQD Sbjct: 8 NQRH-SVIDVTSAKENWNIVVRVIRLWFVTDLAKSKIPFSIELILQD 53 >XP_013445527.1 animal RPA1 domain protein [Medicago truncatula] KEH19553.1 animal RPA1 domain protein [Medicago truncatula] Length = 283 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/50 (46%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +HD +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHDFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_007161930.1 hypothetical protein PHAVU_001G109800g [Phaseolus vulgaris] ESW33924.1 hypothetical protein PHAVU_001G109800g [Phaseolus vulgaris] Length = 472 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 424 DSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQD 296 +S+ I P E W +IARV+ LWFV+DF K K PFSMEMV+QD Sbjct: 9 NSIKDINPESENWILIARVIRLWFVSDFKKNKFPFSMEMVIQD 51 >XP_007134592.1 hypothetical protein PHAVU_010G0596000g, partial [Phaseolus vulgaris] ESW06586.1 hypothetical protein PHAVU_010G0596000g, partial [Phaseolus vulgaris] Length = 113 Score = 57.0 bits (136), Expect = 2e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -2 Query: 418 VSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ + +KE W ++ RVL LW V DF+KQK+PFS+EMVLQD++ Sbjct: 7 LNDVNLSKETWNVVVRVLRLWCVQDFTKQKIPFSLEMVLQDEE 49 >XP_013445015.1 animal RPA1 domain protein [Medicago truncatula] XP_013456439.1 animal RPA1 domain protein [Medicago truncatula] XP_013461041.1 animal RPA1 domain protein [Medicago truncatula] KEH19040.1 animal RPA1 domain protein [Medicago truncatula] KEH30470.1 animal RPA1 domain protein [Medicago truncatula] KEH35075.1 animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_013441177.1 animal RPA1 domain protein, partial [Medicago truncatula] KEH15202.1 animal RPA1 domain protein, partial [Medicago truncatula] Length = 139 Score = 57.4 bits (137), Expect = 3e-07 Identities = 23/47 (48%), Positives = 34/47 (72%) Frame = -2 Query: 430 RHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 +HD S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 4 KHDFNSNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_003613114.1 PIF1 DNA helicase/replication A1-like protein, putative [Medicago truncatula] AES96072.1 PIF1 DNA helicase/replication A1-like protein, putative [Medicago truncatula] Length = 96 Score = 55.8 bits (133), Expect = 4e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 424 DSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 D +S I+P+KE TII RV+ LWFV D K + PFS+EMVL D+K Sbjct: 6 DLISDISPSKENRTIIVRVVRLWFVRDIKKDQFPFSLEMVLMDNK 50 >XP_003595510.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES65761.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 549 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -2 Query: 433 PRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 P+ D +S I+P+KE W I RV+ LWFV D K +LP+S+EMVL D+K Sbjct: 3 PKIDLISDISPSKENWNIRVRVVRLWFVRDMKKDQLPYSLEMVLMDNK 50 >XP_003602586.2 animal RPA1 domain protein [Medicago truncatula] AES72837.2 animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 57.0 bits (136), Expect = 7e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLIDRK 50 >XP_003625314.2 animal RPA1 domain protein [Medicago truncatula] AES81532.2 animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 57.0 bits (136), Expect = 7e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLIDRK 50 >XP_013451975.1 animal RPA1 domain protein [Medicago truncatula] KEH26003.1 animal RPA1 domain protein [Medicago truncatula] Length = 289 Score = 58.2 bits (139), Expect = 8e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_013469460.1 animal RPA1 domain protein [Medicago truncatula] KEH43498.1 animal RPA1 domain protein [Medicago truncatula] Length = 303 Score = 58.2 bits (139), Expect = 9e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV+ WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMELVLMDRK 50 >XP_003629969.2 DUF223 domain protein [Medicago truncatula] AET04445.2 DUF223 domain protein [Medicago truncatula] Length = 306 Score = 58.2 bits (139), Expect = 9e-07 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +HD +S+++P K+ WT++ RV+ WF D+ +KLPFSME VL D K Sbjct: 1 MSTKHDFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLIDRK 50 >XP_007144285.1 hypothetical protein PHAVU_007G143500g [Phaseolus vulgaris] ESW16279.1 hypothetical protein PHAVU_007G143500g [Phaseolus vulgaris] Length = 474 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 418 VSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQD 296 V + P E W +IARV+ LWFV+DF K K PFSMEMV+QD Sbjct: 8 VKDVNPQSENWILIARVIRLWFVSDFKKTKFPFSMEMVIQD 48 >XP_003603933.2 animal RPA1 domain protein [Medicago truncatula] AES74184.2 animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/50 (44%), Positives = 36/50 (72%) Frame = -2 Query: 439 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLPFSMEMVLQDDK 290 ++ +H+ +S+++P K+ WT++ RV WF D+ +KLPFSME+VL D K Sbjct: 1 MSTKHNFISNVSPRKQSWTLVVRVARAWFGQDYKNKKLPFSMELVLIDRK 50