BLASTX nr result
ID: Glycyrrhiza34_contig00012915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00012915 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003630941.1 ankyrin repeat plant-like protein [Medicago trunc... 65 7e-10 XP_004503355.1 PREDICTED: ankyrin repeat-containing protein At2g... 62 4e-09 XP_019432669.1 PREDICTED: ankyrin repeat-containing protein At2g... 62 6e-09 GAU12906.1 hypothetical protein TSUD_73930 [Trifolium subterraneum] 60 4e-08 OIV93452.1 hypothetical protein TanjilG_10084 [Lupinus angustifo... 55 2e-06 XP_019423532.1 PREDICTED: ankyrin repeat-containing protein At2g... 55 2e-06 >XP_003630941.1 ankyrin repeat plant-like protein [Medicago truncatula] AET05417.1 ankyrin repeat plant-like protein [Medicago truncatula] Length = 538 Score = 64.7 bits (156), Expect = 7e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 195 MESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKEED 314 MESK L RFMTHQSIF+ VGSGDLDGLK+L+EKLNKEED Sbjct: 1 MESKGL--RFMTHQSIFTTVGSGDLDGLKKLLEKLNKEED 38 >XP_004503355.1 PREDICTED: ankyrin repeat-containing protein At2g01680-like [Cicer arietinum] Length = 538 Score = 62.4 bits (150), Expect = 4e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 195 MESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKEED 314 MESK L RFMTHQSIFSMVGSGDLDGLK+LVE+L KE++ Sbjct: 1 MESKTL--RFMTHQSIFSMVGSGDLDGLKKLVEELKKEDN 38 >XP_019432669.1 PREDICTED: ankyrin repeat-containing protein At2g01680-like [Lupinus angustifolius] OIW21286.1 hypothetical protein TanjilG_31582 [Lupinus angustifolius] Length = 527 Score = 62.0 bits (149), Expect = 6e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +3 Query: 192 VMESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKE 308 +MESKA+ +RF+THQSIFSMV SGDLDGL++LVE+L+KE Sbjct: 1 MMESKAMNMRFITHQSIFSMVQSGDLDGLRKLVEQLSKE 39 >GAU12906.1 hypothetical protein TSUD_73930 [Trifolium subterraneum] Length = 540 Score = 59.7 bits (143), Expect = 4e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 195 MESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKEED 314 MESK L RFMTHQSIF+MVGSG+LDGLK+L+EKL E+D Sbjct: 1 MESKGL--RFMTHQSIFTMVGSGNLDGLKKLLEKLKNEDD 38 >OIV93452.1 hypothetical protein TanjilG_10084 [Lupinus angustifolius] Length = 526 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 192 VMESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKEEDA 317 +M+SKAL RF+THQSIFS V SGDLDGLK+LVE+L E+ + Sbjct: 1 MMDSKAL--RFITHQSIFSTVRSGDLDGLKELVEELKNEQSS 40 >XP_019423532.1 PREDICTED: ankyrin repeat-containing protein At2g01680-like [Lupinus angustifolius] Length = 527 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 192 VMESKALPLRFMTHQSIFSMVGSGDLDGLKQLVEKLNKEEDA 317 +M+SKAL RF+THQSIFS V SGDLDGLK+LVE+L E+ + Sbjct: 2 MMDSKAL--RFITHQSIFSTVRSGDLDGLKELVEELKNEQSS 41