BLASTX nr result
ID: Glycyrrhiza34_contig00010798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00010798 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006600435.1 PREDICTED: putative SWI/SNF-related matrix-associ... 192 6e-55 XP_012573168.1 PREDICTED: putative SWI/SNF-related matrix-associ... 192 7e-55 XP_004487536.1 PREDICTED: putative SWI/SNF-related matrix-associ... 192 1e-54 XP_012573165.1 PREDICTED: putative SWI/SNF-related matrix-associ... 192 1e-54 GAU35011.1 hypothetical protein TSUD_103340 [Trifolium subterran... 192 1e-54 XP_013464892.1 DNA/RNA helicase [Medicago truncatula] KEH38927.1... 191 3e-54 KHN21465.1 Putative SWI/SNF-related matrix-associated actin-depe... 189 7e-54 XP_006592736.1 PREDICTED: putative SWI/SNF-related matrix-associ... 189 9e-54 XP_006592735.1 PREDICTED: putative SWI/SNF-related matrix-associ... 189 9e-54 KYP51831.1 Putative SWI/SNF-related matrix-associated actin-depe... 188 2e-53 XP_019458903.1 PREDICTED: putative SWI/SNF-related matrix-associ... 188 2e-53 OIW03898.1 hypothetical protein TanjilG_30174 [Lupinus angustifo... 188 2e-53 XP_014496489.1 PREDICTED: putative SWI/SNF-related matrix-associ... 187 4e-53 XP_017425600.1 PREDICTED: putative SWI/SNF-related matrix-associ... 187 4e-53 XP_016170964.1 PREDICTED: putative SWI/SNF-related matrix-associ... 187 6e-53 XP_015935877.1 PREDICTED: putative SWI/SNF-related matrix-associ... 187 6e-53 XP_007150115.1 hypothetical protein PHAVU_005G128000g [Phaseolus... 184 4e-52 XP_017700807.1 PREDICTED: putative SWI/SNF-related matrix-associ... 168 3e-51 XP_017700806.1 PREDICTED: putative SWI/SNF-related matrix-associ... 168 4e-51 KNA21164.1 hypothetical protein SOVF_044780 [Spinacia oleracea] 180 1e-50 >XP_006600435.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 [Glycine max] KRH22740.1 hypothetical protein GLYMA_13G320000 [Glycine max] Length = 1029 Score = 192 bits (489), Expect = 6e-55 Identities = 97/106 (91%), Positives = 103/106 (97%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV +LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT+NNISFV Sbjct: 848 ENRFQVDIEKNWVESCKVTVLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNNISFV 907 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS+T VLLMSLKAGGVGINLTAASNA Sbjct: 908 RLDGTLNLQQREKVIKQFSEDSNTLVLLMSLKAGGVGINLTAASNA 953 >XP_012573168.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X3 [Cicer arietinum] Length = 880 Score = 192 bits (487), Expect = 7e-55 Identities = 98/106 (92%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQIDIEKNW+ESCKV LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT+N ISFV Sbjct: 699 ESRFQIDIEKNWIESCKVTGLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNRISFV 758 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDSD QVLLMSLKAGGVGINLTAASNA Sbjct: 759 RLDGTLNMQQREKVIKQFSEDSDIQVLLMSLKAGGVGINLTAASNA 804 >XP_004487536.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X2 [Cicer arietinum] Length = 1006 Score = 192 bits (487), Expect = 1e-54 Identities = 98/106 (92%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQIDIEKNW+ESCKV LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT+N ISFV Sbjct: 825 ESRFQIDIEKNWIESCKVTGLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNRISFV 884 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDSD QVLLMSLKAGGVGINLTAASNA Sbjct: 885 RLDGTLNMQQREKVIKQFSEDSDIQVLLMSLKAGGVGINLTAASNA 930 >XP_012573165.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Cicer arietinum] Length = 1022 Score = 192 bits (487), Expect = 1e-54 Identities = 98/106 (92%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQIDIEKNW+ESCKV LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT+N ISFV Sbjct: 841 ESRFQIDIEKNWIESCKVTGLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNRISFV 900 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDSD QVLLMSLKAGGVGINLTAASNA Sbjct: 901 RLDGTLNMQQREKVIKQFSEDSDIQVLLMSLKAGGVGINLTAASNA 946 >GAU35011.1 hypothetical protein TSUD_103340 [Trifolium subterraneum] Length = 1050 Score = 192 bits (487), Expect = 1e-54 Identities = 98/106 (92%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQ+DIEKNWVESCK+ LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT+N ISFV Sbjct: 869 ESRFQVDIEKNWVESCKITGLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNKISFV 928 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTLS QQREKVIKQFSEDSD QVLLMSLKAGGVGINLTAASNA Sbjct: 929 RLDGTLSLQQREKVIKQFSEDSDIQVLLMSLKAGGVGINLTAASNA 974 >XP_013464892.1 DNA/RNA helicase [Medicago truncatula] KEH38927.1 DNA/RNA helicase [Medicago truncatula] Length = 1022 Score = 191 bits (484), Expect = 3e-54 Identities = 98/106 (92%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQIDIEKNWVESCKV L+NELENLRSSGSKSIVFSQWTAFLDLLQIPFT+N ISFV Sbjct: 841 ESRFQIDIEKNWVESCKVTGLMNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNKISFV 900 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDSD QVLLMSLKAGGVGINLTAASNA Sbjct: 901 RLDGTLNLQQREKVIKQFSEDSDIQVLLMSLKAGGVGINLTAASNA 946 >KHN21465.1 Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 [Glycine soja] Length = 988 Score = 189 bits (481), Expect = 7e-54 Identities = 96/106 (90%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV +LLNELENL SSGSKSIVFSQWTAFLDLLQIPFT+NNISFV Sbjct: 807 ENRFQVDIEKNWVESCKVTVLLNELENLCSSGSKSIVFSQWTAFLDLLQIPFTRNNISFV 866 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS+T VLLMSLKAGGVGINLTAASNA Sbjct: 867 RLDGTLNLQQREKVIKQFSEDSNTLVLLMSLKAGGVGINLTAASNA 912 >XP_006592736.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X2 [Glycine max] KRH26566.1 hypothetical protein GLYMA_12G180800 [Glycine max] Length = 1003 Score = 189 bits (480), Expect = 9e-54 Identities = 95/106 (89%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV +LLNELENL SSGSKSIVFSQWTAFLDLLQIPFT+NNI FV Sbjct: 822 ENRFQVDIEKNWVESCKVTVLLNELENLCSSGSKSIVFSQWTAFLDLLQIPFTRNNIPFV 881 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVIKQFSED +T VLLMSLKAGGVGINLTAASNA Sbjct: 882 RLDGTLNQQQREKVIKQFSEDGETLVLLMSLKAGGVGINLTAASNA 927 >XP_006592735.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Glycine max] Length = 1012 Score = 189 bits (480), Expect = 9e-54 Identities = 95/106 (89%), Positives = 101/106 (95%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV +LLNELENL SSGSKSIVFSQWTAFLDLLQIPFT+NNI FV Sbjct: 822 ENRFQVDIEKNWVESCKVTVLLNELENLCSSGSKSIVFSQWTAFLDLLQIPFTRNNIPFV 881 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVIKQFSED +T VLLMSLKAGGVGINLTAASNA Sbjct: 882 RLDGTLNQQQREKVIKQFSEDGETLVLLMSLKAGGVGINLTAASNA 927 >KYP51831.1 Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 [Cajanus cajan] Length = 1006 Score = 188 bits (477), Expect = 2e-53 Identities = 94/106 (88%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNW+ESCKV +LLNELENLRSSGSKSIVFSQWTAFLDLLQIPFT++NISFV Sbjct: 825 ENRFQVDIEKNWIESCKVTVLLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTRSNISFV 884 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS+T VLLMSLKAGGVGINL AASNA Sbjct: 885 RLDGTLNLQQREKVIKQFSEDSNTLVLLMSLKAGGVGINLPAASNA 930 >XP_019458903.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Lupinus angustifolius] Length = 1020 Score = 188 bits (477), Expect = 2e-53 Identities = 95/106 (89%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 +SRF++DIEKNWVESCKV ILL+ELENLRSSGSKSIVFSQWTAFLDLLQIPFT+NNIS+V Sbjct: 839 DSRFKVDIEKNWVESCKVTILLHELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNNISYV 898 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS T VLLMSLKAGGVGINLTAASNA Sbjct: 899 RLDGTLNLQQREKVIKQFSEDSSTLVLLMSLKAGGVGINLTAASNA 944 >OIW03898.1 hypothetical protein TanjilG_30174 [Lupinus angustifolius] Length = 1036 Score = 188 bits (477), Expect = 2e-53 Identities = 95/106 (89%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 +SRF++DIEKNWVESCKV ILL+ELENLRSSGSKSIVFSQWTAFLDLLQIPFT+NNIS+V Sbjct: 855 DSRFKVDIEKNWVESCKVTILLHELENLRSSGSKSIVFSQWTAFLDLLQIPFTRNNISYV 914 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS T VLLMSLKAGGVGINLTAASNA Sbjct: 915 RLDGTLNLQQREKVIKQFSEDSSTLVLLMSLKAGGVGINLTAASNA 960 >XP_014496489.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 [Vigna radiata var. radiata] Length = 999 Score = 187 bits (475), Expect = 4e-53 Identities = 95/106 (89%), Positives = 100/106 (94%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV LLNEL+NLRSSGSKSIVFSQWTAFLDLLQIPF +NNISFV Sbjct: 818 ENRFQVDIEKNWVESCKVTALLNELQNLRSSGSKSIVFSQWTAFLDLLQIPFARNNISFV 877 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS T VLLMSLKAGGVGINLTAASNA Sbjct: 878 RLDGTLNLQQREKVIKQFSEDSTTLVLLMSLKAGGVGINLTAASNA 923 >XP_017425600.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 [Vigna angularis] KOM44122.1 hypothetical protein LR48_Vigan05g172700 [Vigna angularis] BAT92035.1 hypothetical protein VIGAN_07069300 [Vigna angularis var. angularis] Length = 999 Score = 187 bits (475), Expect = 4e-53 Identities = 95/106 (89%), Positives = 100/106 (94%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 E+RFQ+DIEKNWVESCKV LLNEL+NLRSSGSKSIVFSQWTAFLDLLQIPF +NNISFV Sbjct: 818 ENRFQVDIEKNWVESCKVTALLNELQNLRSSGSKSIVFSQWTAFLDLLQIPFARNNISFV 877 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS T VLLMSLKAGGVGINLTAASNA Sbjct: 878 RLDGTLNLQQREKVIKQFSEDSTTLVLLMSLKAGGVGINLTAASNA 923 >XP_016170964.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Arachis ipaensis] Length = 1024 Score = 187 bits (474), Expect = 6e-53 Identities = 93/106 (87%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 +SRFQIDIEKNW+ESCKV +LL+ELE+LR+SGSKSIVFSQWTAFLDLLQIPFT+NNISFV Sbjct: 843 DSRFQIDIEKNWIESCKVTVLLHELESLRASGSKSIVFSQWTAFLDLLQIPFTRNNISFV 902 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVIKQFSED + VLLMSLKAGGVGINLTAASNA Sbjct: 903 RLDGTLNQQQREKVIKQFSEDDEILVLLMSLKAGGVGINLTAASNA 948 >XP_015935877.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Arachis duranensis] Length = 1024 Score = 187 bits (474), Expect = 6e-53 Identities = 93/106 (87%), Positives = 102/106 (96%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 +SRFQIDIEKNW+ESCKV +LL+ELE+LR+SGSKSIVFSQWTAFLDLLQIPFT+NNISFV Sbjct: 843 DSRFQIDIEKNWIESCKVTVLLHELESLRASGSKSIVFSQWTAFLDLLQIPFTRNNISFV 902 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVIKQFSED + VLLMSLKAGGVGINLTAASNA Sbjct: 903 RLDGTLNQQQREKVIKQFSEDDEILVLLMSLKAGGVGINLTAASNA 948 >XP_007150115.1 hypothetical protein PHAVU_005G128000g [Phaseolus vulgaris] ESW22109.1 hypothetical protein PHAVU_005G128000g [Phaseolus vulgaris] Length = 1000 Score = 184 bits (468), Expect = 4e-52 Identities = 94/106 (88%), Positives = 100/106 (94%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ++RFQ+DIEKNWVESCKV LLNEL+NL SSGSKSIVFSQWTAFLDLLQIPFT+NNISFV Sbjct: 819 DNRFQVDIEKNWVESCKVTALLNELKNLCSSGSKSIVFSQWTAFLDLLQIPFTRNNISFV 878 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+ QQREKVIKQFSEDS T VLLMSLKAGGVGINLTAASNA Sbjct: 879 RLDGTLNLQQREKVIKQFSEDSTTLVLLMSLKAGGVGINLTAASNA 924 >XP_017700807.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X2 [Phoenix dactylifera] Length = 193 Score = 168 bits (426), Expect = 3e-51 Identities = 85/106 (80%), Positives = 96/106 (90%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ++RFQIDIEKNWVES KV++LL ELENLRS G+KSIVFSQWTAFLDLLQIP ++ N++FV Sbjct: 12 DNRFQIDIEKNWVESSKVSVLLRELENLRSLGAKSIVFSQWTAFLDLLQIPLSRCNLTFV 71 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVI FSED + VLLMSLKAGGVGINLTAASNA Sbjct: 72 RLDGTLNQQQREKVINDFSEDENILVLLMSLKAGGVGINLTAASNA 117 >XP_017700806.1 PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 isoform X1 [Phoenix dactylifera] Length = 199 Score = 168 bits (426), Expect = 4e-51 Identities = 85/106 (80%), Positives = 96/106 (90%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ++RFQIDIEKNWVES KV++LL ELENLRS G+KSIVFSQWTAFLDLLQIP ++ N++FV Sbjct: 18 DNRFQIDIEKNWVESSKVSVLLRELENLRSLGAKSIVFSQWTAFLDLLQIPLSRCNLTFV 77 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTL+QQQREKVI FSED + VLLMSLKAGGVGINLTAASNA Sbjct: 78 RLDGTLNQQQREKVINDFSEDENILVLLMSLKAGGVGINLTAASNA 123 >KNA21164.1 hypothetical protein SOVF_044780 [Spinacia oleracea] Length = 1030 Score = 180 bits (457), Expect = 1e-50 Identities = 91/106 (85%), Positives = 100/106 (94%) Frame = -1 Query: 318 ESRFQIDIEKNWVESCKVAILLNELENLRSSGSKSIVFSQWTAFLDLLQIPFTQNNISFV 139 ESRFQID+EKNWVES KV+ LL ELENLR+SGSKSIVFSQWTAFLDLL+IP T+NNISF+ Sbjct: 849 ESRFQIDVEKNWVESTKVSSLLCELENLRASGSKSIVFSQWTAFLDLLEIPLTRNNISFL 908 Query: 138 RLDGTLSQQQREKVIKQFSEDSDTQVLLMSLKAGGVGINLTAASNA 1 RLDGTLSQQQRE+V+K+FSEDSD VLLMSLKAGGVGINLTAASNA Sbjct: 909 RLDGTLSQQQRERVLKKFSEDSDVMVLLMSLKAGGVGINLTAASNA 954