BLASTX nr result
ID: Glycyrrhiza34_contig00010614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00010614 (624 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019453993.1 PREDICTED: interactor of constitutive active ROPs... 210 3e-61 XP_019448680.1 PREDICTED: interactor of constitutive active ROPs... 209 1e-60 XP_003538038.1 PREDICTED: interactor of constitutive active ROPs... 207 3e-60 XP_003539735.1 PREDICTED: interactor of constitutive active ROPs... 206 1e-59 XP_013456037.1 interactor of constitutive active ROPs-like prote... 202 4e-58 KHN22038.1 Interactor of constitutive active ROPs 3 [Glycine soja] 197 2e-56 XP_014628594.1 PREDICTED: interactor of constitutive active ROPs... 197 2e-56 XP_017433410.1 PREDICTED: interactor of constitutive active ROPs... 196 5e-56 XP_014494103.1 PREDICTED: interactor of constitutive active ROPs... 196 5e-56 XP_004505951.1 PREDICTED: interactor of constitutive active ROPs... 195 1e-55 KHN05714.1 Interactor of constitutive active ROPs 3 [Glycine soja] 195 1e-55 XP_006592232.1 PREDICTED: interactor of constitutive active ROPs... 195 1e-55 XP_019413957.1 PREDICTED: interactor of constitutive active ROPs... 195 2e-55 GAU14647.1 hypothetical protein TSUD_97110 [Trifolium subterraneum] 194 5e-55 XP_007132172.1 hypothetical protein PHAVU_011G072000g [Phaseolus... 193 5e-55 KRG89052.1 hypothetical protein GLYMA_U021100 [Glycine max] 193 6e-55 XP_013456038.1 interactor of constitutive active ROPs-like prote... 193 6e-55 XP_019413966.1 PREDICTED: interactor of constitutive active ROPs... 191 5e-54 XP_019413963.1 PREDICTED: interactor of constitutive active ROPs... 188 5e-53 XP_014494102.1 PREDICTED: interactor of constitutive active ROPs... 186 5e-52 >XP_019453993.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453994.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453995.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453996.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453998.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453999.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] Length = 616 Score = 210 bits (534), Expect = 3e-61 Identities = 112/141 (79%), Positives = 120/141 (85%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRAVRQLR ANKISKERSPKV DR+SPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAVRQLRTTALDTGSVSSLSQANKISKERSPKVVDRKSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PVPERKRPSRIS+LESQISQLQ+DLKKV+DQLILSESCK QAQ+DAEESKEQLL+LSAKL Sbjct: 61 PVPERKRPSRISDLESQISQLQEDLKKVKDQLILSESCKNQAQEDAEESKEQLLALSAKL 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQKQ LEL TG+A VTEL Sbjct: 121 EDSQKQLLELSGTGKAHVTEL 141 >XP_019448680.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448681.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448682.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448683.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448684.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448685.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448686.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] OIW08590.1 hypothetical protein TanjilG_03266 [Lupinus angustifolius] Length = 617 Score = 209 bits (531), Expect = 1e-60 Identities = 111/141 (78%), Positives = 118/141 (83%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPR VRQLR ANKISKE+SPKV DR+SPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRVVRQLRTTTVDTGSVSSLSQANKISKEKSPKVTDRKSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PVPE+KRPSRISELESQISQLQ+DLKKV+DQLI +ESCKKQAQQDAEESKEQLL LSA L Sbjct: 61 PVPEKKRPSRISELESQISQLQEDLKKVKDQLIFTESCKKQAQQDAEESKEQLLVLSANL 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQKQ LEL TGEARVTEL Sbjct: 121 EDSQKQLLELSATGEARVTEL 141 >XP_003538038.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_006591017.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_006591018.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_014628595.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] KRG89046.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89047.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89048.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89049.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89050.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89051.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 207 bits (528), Expect = 3e-60 Identities = 111/141 (78%), Positives = 120/141 (85%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRAVR+L+ A K SKERSPKV DRRSPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAVRKLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV ERKRPS+ISELESQISQLQ+DLKKV+DQLILSESCKKQAQQ+AEESKEQLL+LSAKL Sbjct: 61 PVVERKRPSKISELESQISQLQNDLKKVKDQLILSESCKKQAQQEAEESKEQLLALSAKL 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 EESQKQ L+LC+TGEARV EL Sbjct: 121 EESQKQVLDLCSTGEARVLEL 141 >XP_003539735.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_003539736.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592228.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592229.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592230.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592231.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_014620044.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] KRH24934.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24935.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24936.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24937.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24938.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24939.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24940.1 hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 206 bits (523), Expect = 1e-59 Identities = 110/141 (78%), Positives = 118/141 (83%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTR+GSS+VP KVSPRAVRQL+ A K SKERSPKV DRRSPRS Sbjct: 1 MQTPKTRNGSSDVPQKVSPRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV ERKRPS+ISELESQISQLQ+DLKKVRDQ ILSESCKKQAQQ+AEESKEQLL+LSAKL Sbjct: 61 PVIERKRPSKISELESQISQLQNDLKKVRDQFILSESCKKQAQQEAEESKEQLLALSAKL 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 EESQKQ L+LC TGEARV EL Sbjct: 121 EESQKQVLDLCATGEARVLEL 141 >XP_013456037.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] KEH30068.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 620 Score = 202 bits (513), Expect = 4e-58 Identities = 113/144 (78%), Positives = 119/144 (82%), Gaps = 3/144 (2%) Frame = +1 Query: 199 MQTPKTRSGSSEV-PLKVSPRAVRQLRXXXXXXXXXXXXXXA--NKISKERSPKVADRRS 369 M TPKTRSGSSEV P KVSPRAVRQLR +KISKERS K+ADR+S Sbjct: 1 MHTPKTRSGSSEVVPKKVSPRAVRQLRTTTTLDTDSVSSSSTQTSKISKERSSKLADRKS 60 Query: 370 PRSPVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLS 549 PRSPVPERKRPS+ISELESQISQLQDDLKKV+DQLILSESCKKQAQQD EESKEQLL+LS Sbjct: 61 PRSPVPERKRPSKISELESQISQLQDDLKKVKDQLILSESCKKQAQQDFEESKEQLLALS 120 Query: 550 AKLEESQKQYLELCTTGEARVTEL 621 AKLEESQKQYLELC TGEAR EL Sbjct: 121 AKLEESQKQYLELCATGEARDIEL 144 >KHN22038.1 Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 197 bits (501), Expect = 2e-56 Identities = 106/136 (77%), Positives = 115/136 (84%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPER 393 TRSGSSEVP KVSPRAVR+L+ A K SKERSPKV DRRSPRSPV ER Sbjct: 6 TRSGSSEVPQKVSPRAVRKLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVVER 65 Query: 394 KRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQK 573 KRPS+ISELESQISQLQ+DLKKV+DQLILSESCKKQAQQ+AEESKEQLL+LSAKLEESQK Sbjct: 66 KRPSKISELESQISQLQNDLKKVKDQLILSESCKKQAQQEAEESKEQLLALSAKLEESQK 125 Query: 574 QYLELCTTGEARVTEL 621 Q L+LC+TGEARV EL Sbjct: 126 QVLDLCSTGEARVLEL 141 >XP_014628594.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Glycine max] KRG89053.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89054.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89055.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89056.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 197 bits (501), Expect = 2e-56 Identities = 106/136 (77%), Positives = 115/136 (84%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPER 393 TRSGSSEVP KVSPRAVR+L+ A K SKERSPKV DRRSPRSPV ER Sbjct: 6 TRSGSSEVPQKVSPRAVRKLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVVER 65 Query: 394 KRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQK 573 KRPS+ISELESQISQLQ+DLKKV+DQLILSESCKKQAQQ+AEESKEQLL+LSAKLEESQK Sbjct: 66 KRPSKISELESQISQLQNDLKKVKDQLILSESCKKQAQQEAEESKEQLLALSAKLEESQK 125 Query: 574 QYLELCTTGEARVTEL 621 Q L+LC+TGEARV EL Sbjct: 126 QVLDLCSTGEARVLEL 141 >XP_017433410.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433411.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433412.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433414.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433415.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433416.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433417.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433418.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433419.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433420.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433421.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433422.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433423.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433424.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] XP_017433425.1 PREDICTED: interactor of constitutive active ROPs 3 [Vigna angularis] Length = 604 Score = 196 bits (498), Expect = 5e-56 Identities = 106/141 (75%), Positives = 113/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRAVRQLR ANK SKERSPKV DRRSPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAVRQLRPTTVETDSVSSSSQANKSSKERSPKVTDRRSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV ERKRPS+ISELESQISQLQ+DLKKV DQL+LSES K+QAQQDA ESKEQLL+LSAK Sbjct: 61 PVVERKRPSKISELESQISQLQNDLKKVMDQLVLSESSKRQAQQDALESKEQLLALSAKF 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQK L+LC GE RV EL Sbjct: 121 EDSQKHVLDLCAAGEGRVLEL 141 >XP_014494103.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494104.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494105.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494106.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494107.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494108.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494109.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494110.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494111.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494112.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494113.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494114.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494115.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494116.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494117.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] XP_014494118.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Vigna radiata var. radiata] Length = 604 Score = 196 bits (498), Expect = 5e-56 Identities = 106/141 (75%), Positives = 113/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRAVRQLR ANK SKERSPKV DRRSPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAVRQLRPTTVDTDSVSSSSQANKSSKERSPKVTDRRSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV ERKRPS+ISELESQISQLQ+DLKKV DQL+LSES K+QAQQDA ESKEQLL+LSAK Sbjct: 61 PVVERKRPSKISELESQISQLQNDLKKVMDQLVLSESSKRQAQQDALESKEQLLALSAKF 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQK L+LC GE RV EL Sbjct: 121 EDSQKHVLDLCAAGEGRVLEL 141 >XP_004505951.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_004505952.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_012572777.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_012572778.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] Length = 611 Score = 195 bits (496), Expect = 1e-55 Identities = 107/147 (72%), Positives = 119/147 (80%), Gaps = 6/147 (4%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXAN------KISKERSPKVAD 360 MQTPKTRSGSSEVP KVSPR++RQL+ ++ KISKERSPKV D Sbjct: 1 MQTPKTRSGSSEVPHKVSPRSIRQLKTTTRLDIDSVSSSSSSSQANNTKISKERSPKVID 60 Query: 361 RRSPRSPVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLL 540 RRSPRSPVPERKRPSRISELESQISQLQD+LKKV+DQLILSES KK++QQDAEESKE+LL Sbjct: 61 RRSPRSPVPERKRPSRISELESQISQLQDELKKVKDQLILSESSKKKSQQDAEESKEKLL 120 Query: 541 SLSAKLEESQKQYLELCTTGEARVTEL 621 +LSAKLEESQ QY+EL TGEAR EL Sbjct: 121 TLSAKLEESQNQYIELVATGEARDVEL 147 >KHN05714.1 Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 195 bits (496), Expect = 1e-55 Identities = 105/136 (77%), Positives = 113/136 (83%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPER 393 TR+GSS+VP KVSPRAVRQL+ A K SKERSPKV DRRSPRSPV ER Sbjct: 6 TRNGSSDVPQKVSPRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIER 65 Query: 394 KRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQK 573 KRPS+ISELESQISQLQ+DLKKVRDQ ILSESCKKQAQQ+AEESKEQLL+LSAKLEESQK Sbjct: 66 KRPSKISELESQISQLQNDLKKVRDQFILSESCKKQAQQEAEESKEQLLALSAKLEESQK 125 Query: 574 QYLELCTTGEARVTEL 621 Q L+LC TGEARV EL Sbjct: 126 QVLDLCATGEARVLEL 141 >XP_006592232.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Glycine max] KRH24941.1 hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 195 bits (496), Expect = 1e-55 Identities = 105/136 (77%), Positives = 113/136 (83%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPER 393 TR+GSS+VP KVSPRAVRQL+ A K SKERSPKV DRRSPRSPV ER Sbjct: 6 TRNGSSDVPQKVSPRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIER 65 Query: 394 KRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQK 573 KRPS+ISELESQISQLQ+DLKKVRDQ ILSESCKKQAQQ+AEESKEQLL+LSAKLEESQK Sbjct: 66 KRPSKISELESQISQLQNDLKKVRDQFILSESCKKQAQQEAEESKEQLLALSAKLEESQK 125 Query: 574 QYLELCTTGEARVTEL 621 Q L+LC TGEARV EL Sbjct: 126 QVLDLCATGEARVLEL 141 >XP_019413957.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413958.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413959.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413960.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413961.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413962.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] OIV99349.1 hypothetical protein TanjilG_17159 [Lupinus angustifolius] Length = 617 Score = 195 bits (495), Expect = 2e-55 Identities = 106/141 (75%), Positives = 114/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRA+R+LR ANKISKERSP A R+SPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAIRRLRTTTLEMGSVSSLRQANKISKERSPNAAGRKSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV E+KRPSRISELESQISQLQ+DLKKVRDQLILSESCKKQAQQDAEESK+QLL+LSAKL Sbjct: 61 PVSEKKRPSRISELESQISQLQEDLKKVRDQLILSESCKKQAQQDAEESKKQLLALSAKL 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQKQ LEL T E V L Sbjct: 121 EDSQKQLLELSATEEDHVIVL 141 >GAU14647.1 hypothetical protein TSUD_97110 [Trifolium subterraneum] Length = 616 Score = 194 bits (492), Expect = 5e-55 Identities = 106/139 (76%), Positives = 115/139 (82%), Gaps = 3/139 (2%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXA---NKISKERSPKVADRRSPRSPV 384 TRSGSSEVP K+SPRAVRQLR + +KISKERSPKV DR+SPRSPV Sbjct: 3 TRSGSSEVPHKISPRAVRQLRTTTTLDTVSVSSSSSTQTSKISKERSPKVVDRKSPRSPV 62 Query: 385 PERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEE 564 PERKRPS+ISELESQISQL+++LKKV+DQLILSESCKKQAQQDAEESKEQL LSAKLEE Sbjct: 63 PERKRPSKISELESQISQLKENLKKVKDQLILSESCKKQAQQDAEESKEQLSILSAKLEE 122 Query: 565 SQKQYLELCTTGEARVTEL 621 SQKQYLELC TGEAR EL Sbjct: 123 SQKQYLELCATGEARDIEL 141 >XP_007132172.1 hypothetical protein PHAVU_011G072000g [Phaseolus vulgaris] ESW04166.1 hypothetical protein PHAVU_011G072000g [Phaseolus vulgaris] Length = 604 Score = 193 bits (491), Expect = 5e-55 Identities = 104/141 (73%), Positives = 113/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSE+P KVSPRAVRQLR ANK +KERSPKV DRRSPRS Sbjct: 1 MQTPKTRSGSSEMPQKVSPRAVRQLRPTTVDIDSVSSSSQANKSAKERSPKVTDRRSPRS 60 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV ERKRPS+ISELESQISQLQ+DLKKV DQL++SES K+QAQQDA ESKEQLL+LSAK Sbjct: 61 PVIERKRPSKISELESQISQLQNDLKKVMDQLVVSESSKRQAQQDALESKEQLLALSAKF 120 Query: 559 EESQKQYLELCTTGEARVTEL 621 EESQK L+LC GE RV EL Sbjct: 121 EESQKHVLDLCAAGEGRVLEL 141 >KRG89052.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 617 Score = 193 bits (491), Expect = 6e-55 Identities = 104/134 (77%), Positives = 113/134 (84%) Frame = +1 Query: 220 SGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPERKR 399 SGSSEVP KVSPRAVR+L+ A K SKERSPKV DRRSPRSPV ERKR Sbjct: 10 SGSSEVPQKVSPRAVRKLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVVERKR 69 Query: 400 PSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQKQY 579 PS+ISELESQISQLQ+DLKKV+DQLILSESCKKQAQQ+AEESKEQLL+LSAKLEESQKQ Sbjct: 70 PSKISELESQISQLQNDLKKVKDQLILSESCKKQAQQEAEESKEQLLALSAKLEESQKQV 129 Query: 580 LELCTTGEARVTEL 621 L+LC+TGEARV EL Sbjct: 130 LDLCSTGEARVLEL 143 >XP_013456038.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] KEH30069.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 617 Score = 193 bits (491), Expect = 6e-55 Identities = 109/139 (78%), Positives = 115/139 (82%), Gaps = 3/139 (2%) Frame = +1 Query: 214 TRSGSSEV-PLKVSPRAVRQLRXXXXXXXXXXXXXXA--NKISKERSPKVADRRSPRSPV 384 TRSGSSEV P KVSPRAVRQLR +KISKERS K+ADR+SPRSPV Sbjct: 3 TRSGSSEVVPKKVSPRAVRQLRTTTTLDTDSVSSSSTQTSKISKERSSKLADRKSPRSPV 62 Query: 385 PERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEE 564 PERKRPS+ISELESQISQLQDDLKKV+DQLILSESCKKQAQQD EESKEQLL+LSAKLEE Sbjct: 63 PERKRPSKISELESQISQLQDDLKKVKDQLILSESCKKQAQQDFEESKEQLLALSAKLEE 122 Query: 565 SQKQYLELCTTGEARVTEL 621 SQKQYLELC TGEAR EL Sbjct: 123 SQKQYLELCATGEARDIEL 141 >XP_019413966.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X3 [Lupinus angustifolius] Length = 604 Score = 191 bits (484), Expect = 5e-54 Identities = 106/141 (75%), Positives = 114/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKTRSGSSEVP KVSPRA+R+LR ANKISKERSP A R+SPRS Sbjct: 1 MQTPKTRSGSSEVPQKVSPRAIRRLRQ-------------ANKISKERSPNAAGRKSPRS 47 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV E+KRPSRISELESQISQLQ+DLKKVRDQLILSESCKKQAQQDAEESK+QLL+LSAKL Sbjct: 48 PVSEKKRPSRISELESQISQLQEDLKKVRDQLILSESCKKQAQQDAEESKKQLLALSAKL 107 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQKQ LEL T E V L Sbjct: 108 EDSQKQLLELSATEEDHVIVL 128 >XP_019413963.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Lupinus angustifolius] XP_019413965.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Lupinus angustifolius] Length = 616 Score = 188 bits (478), Expect = 5e-53 Identities = 105/141 (74%), Positives = 113/141 (80%) Frame = +1 Query: 199 MQTPKTRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRS 378 MQTPKT SGSSEVP KVSPRA+R+LR ANKISKERSP A R+SPRS Sbjct: 1 MQTPKT-SGSSEVPQKVSPRAIRRLRTTTLEMGSVSSLRQANKISKERSPNAAGRKSPRS 59 Query: 379 PVPERKRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKL 558 PV E+KRPSRISELESQISQLQ+DLKKVRDQLILSESCKKQAQQDAEESK+QLL+LSAKL Sbjct: 60 PVSEKKRPSRISELESQISQLQEDLKKVRDQLILSESCKKQAQQDAEESKKQLLALSAKL 119 Query: 559 EESQKQYLELCTTGEARVTEL 621 E+SQKQ LEL T E V L Sbjct: 120 EDSQKQLLELSATEEDHVIVL 140 >XP_014494102.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Vigna radiata var. radiata] Length = 609 Score = 186 bits (471), Expect = 5e-52 Identities = 101/136 (74%), Positives = 108/136 (79%) Frame = +1 Query: 214 TRSGSSEVPLKVSPRAVRQLRXXXXXXXXXXXXXXANKISKERSPKVADRRSPRSPVPER 393 TRSGSSEVP KVSPRAVRQLR ANK SKERSPKV DRRSPRSPV ER Sbjct: 11 TRSGSSEVPQKVSPRAVRQLRPTTVDTDSVSSSSQANKSSKERSPKVTDRRSPRSPVVER 70 Query: 394 KRPSRISELESQISQLQDDLKKVRDQLILSESCKKQAQQDAEESKEQLLSLSAKLEESQK 573 KRPS+ISELESQISQLQ+DLKKV DQL+LSES K+QAQQDA ESKEQLL+LSAK E+SQK Sbjct: 71 KRPSKISELESQISQLQNDLKKVMDQLVLSESSKRQAQQDALESKEQLLALSAKFEDSQK 130 Query: 574 QYLELCTTGEARVTEL 621 L+LC GE RV EL Sbjct: 131 HVLDLCAAGEGRVLEL 146