BLASTX nr result
ID: Glycyrrhiza34_contig00010542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00010542 (620 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAP13077.1 auxin responsive protein IAA-Re [Gossypium barbadense] 91 1e-20 XP_014512035.1 PREDICTED: auxin-induced protein 22B [Vigna radia... 93 3e-20 2M1M_A Chain A, Solution Structure Of The Psiaa4 Oligomerization... 91 3e-20 XP_017413350.1 PREDICTED: auxin-induced protein 22B-like [Vigna ... 93 3e-20 XP_007034953.2 PREDICTED: auxin-responsive protein IAA4 [Theobro... 93 3e-20 XP_007143879.1 hypothetical protein PHAVU_007G109700g [Phaseolus... 93 3e-20 KRH34375.1 hypothetical protein GLYMA_10G180000, partial [Glycin... 91 4e-20 XP_003535418.1 PREDICTED: auxin-induced protein 22B [Glycine max] 91 5e-20 XP_004495393.1 PREDICTED: auxin-induced protein 22B-like [Cicer ... 92 5e-20 XP_013466973.1 auxin response factor [Medicago truncatula] AFK34... 92 8e-20 KYP46364.1 Auxin-induced protein 22B [Cajanus cajan] 92 9e-20 AFK43880.1 unknown [Lotus japonicus] 92 9e-20 XP_004498012.1 PREDICTED: auxin-induced protein IAA4-like [Cicer... 92 1e-19 XP_003520159.1 PREDICTED: auxin-induced protein 22B-like [Glycin... 92 1e-19 XP_016729085.1 PREDICTED: auxin-responsive protein IAA4-like [Go... 91 2e-19 AAQ74955.1 Gbiaa-Re [Gossypium barbadense] 91 2e-19 P49679.1 RecName: Full=Auxin-induced protein IAA4 CAA48297.1 aux... 91 2e-19 KHN30562.1 Auxin-induced protein 22B [Glycine soja] 91 3e-19 XP_007145935.1 hypothetical protein PHAVU_007G280300g [Phaseolus... 91 3e-19 KHN05056.1 Auxin-induced protein 22B [Glycine soja] 91 3e-19 >AAP13077.1 auxin responsive protein IAA-Re [Gossypium barbadense] Length = 91 Score = 91.3 bits (225), Expect = 1e-20 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 51 YEDKDGDWMLVGDVPWEMFITSCKRLRIMKGSEARGLGCGV 91 >XP_014512035.1 PREDICTED: auxin-induced protein 22B [Vigna radiata var. radiata] Length = 182 Score = 93.2 bits (230), Expect = 3e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 142 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 182 >2M1M_A Chain A, Solution Structure Of The Psiaa4 Oligomerization Domain Reveals Interaction Modes For Transcription Factors In Early Auxin Response Length = 107 Score = 90.9 bits (224), Expect = 3e-20 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKG+EA+GLGCGV Sbjct: 64 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGLGCGV 104 >XP_017413350.1 PREDICTED: auxin-induced protein 22B-like [Vigna angularis] KOM35582.1 hypothetical protein LR48_Vigan02g173200 [Vigna angularis] Length = 190 Score = 93.2 bits (230), Expect = 3e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 150 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 190 >XP_007034953.2 PREDICTED: auxin-responsive protein IAA4 [Theobroma cacao] Length = 192 Score = 93.2 bits (230), Expect = 3e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 152 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 192 >XP_007143879.1 hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] ESW15873.1 hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] Length = 193 Score = 93.2 bits (230), Expect = 3e-20 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 153 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 193 >KRH34375.1 hypothetical protein GLYMA_10G180000, partial [Glycine max] Length = 122 Score = 90.9 bits (224), Expect = 4e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 82 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 122 >XP_003535418.1 PREDICTED: auxin-induced protein 22B [Glycine max] Length = 125 Score = 90.9 bits (224), Expect = 5e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 85 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 125 >XP_004495393.1 PREDICTED: auxin-induced protein 22B-like [Cicer arietinum] Length = 183 Score = 92.4 bits (228), Expect = 5e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARG+GCGV Sbjct: 143 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGIGCGV 183 >XP_013466973.1 auxin response factor [Medicago truncatula] AFK34460.1 unknown [Medicago truncatula] KEH41009.1 auxin response factor [Medicago truncatula] Length = 186 Score = 92.0 bits (227), Expect = 8e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 146 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 186 >KYP46364.1 Auxin-induced protein 22B [Cajanus cajan] Length = 191 Score = 92.0 bits (227), Expect = 9e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMF+TSCKRLRIMKGSEARGLGCGV Sbjct: 151 YEDKDGDWMLVGDVPWDMFMTSCKRLRIMKGSEARGLGCGV 191 >AFK43880.1 unknown [Lotus japonicus] Length = 177 Score = 91.7 bits (226), Expect = 9e-20 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPW+MFVTSCKRLRIMKGSEARGLGCGV Sbjct: 137 YEDKDGDWMLVGDVPWEMFVTSCKRLRIMKGSEARGLGCGV 177 >XP_004498012.1 PREDICTED: auxin-induced protein IAA4-like [Cicer arietinum] Length = 195 Score = 92.0 bits (227), Expect = 1e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 155 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 195 >XP_003520159.1 PREDICTED: auxin-induced protein 22B-like [Glycine max] KHN15404.1 Auxin-induced protein 22B [Glycine soja] KRH69048.1 hypothetical protein GLYMA_02G000500 [Glycine max] Length = 192 Score = 91.7 bits (226), Expect = 1e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMF+TSCKRLR+MKGSEARGLGCGV Sbjct: 152 YEDKDGDWMLVGDVPWDMFMTSCKRLRVMKGSEARGLGCGV 192 >XP_016729085.1 PREDICTED: auxin-responsive protein IAA4-like [Gossypium hirsutum] XP_017632291.1 PREDICTED: auxin-responsive protein IAA4-like [Gossypium arboreum] Length = 190 Score = 91.3 bits (225), Expect = 2e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 150 YEDKDGDWMLVGDVPWEMFITSCKRLRIMKGSEARGLGCGV 190 >AAQ74955.1 Gbiaa-Re [Gossypium barbadense] Length = 190 Score = 91.3 bits (225), Expect = 2e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 150 YEDKDGDWMLVGDVPWEMFITSCKRLRIMKGSEARGLGCGV 190 >P49679.1 RecName: Full=Auxin-induced protein IAA4 CAA48297.1 auxin-induced protein [Pisum sativum] Length = 189 Score = 90.9 bits (224), Expect = 2e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKG+EA+GLGCGV Sbjct: 149 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGLGCGV 189 >KHN30562.1 Auxin-induced protein 22B [Glycine soja] Length = 192 Score = 90.9 bits (224), Expect = 3e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 152 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 192 >XP_007145935.1 hypothetical protein PHAVU_007G280300g [Phaseolus vulgaris] ESW17929.1 hypothetical protein PHAVU_007G280300g [Phaseolus vulgaris] Length = 192 Score = 90.9 bits (224), Expect = 3e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFV SCKRLRIMKGSEARGLGCGV Sbjct: 152 YEDKDGDWMLVGDVPWDMFVISCKRLRIMKGSEARGLGCGV 192 >KHN05056.1 Auxin-induced protein 22B [Glycine soja] Length = 194 Score = 90.9 bits (224), Expect = 3e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 620 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 498 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 154 YEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 194