BLASTX nr result
ID: Glycyrrhiza34_contig00008997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008997 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH03196.1 hypothetical protein GLYMA_17G082900 [Glycine max] 74 1e-14 XP_007155193.1 hypothetical protein PHAVU_003G181200g [Phaseolus... 67 5e-12 XP_004508639.1 PREDICTED: cysteine-rich and transmembrane domain... 65 2e-11 KHN18396.1 hypothetical protein glysoja_006809 [Glycine soja] 63 2e-10 XP_003524498.1 PREDICTED: cysteine-rich and transmembrane domain... 62 5e-10 XP_013458040.1 hypothetical protein MTR_4g112890 [Medicago trunc... 57 3e-08 XP_003609184.1 hypothetical protein MTR_4g112890 [Medicago trunc... 57 4e-08 >KRH03196.1 hypothetical protein GLYMA_17G082900 [Glycine max] Length = 75 Score = 73.6 bits (179), Expect = 1e-14 Identities = 40/62 (64%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = +2 Query: 128 SNMSDHNQPQVWNNSGVADKSKDTVAGP-YQVPSPAIAIAITHE--APPSGETKFKGSGF 298 S+ +D NQPQVWN S +A +SKD GP YQVP PAI ITHE PP+GETKFKG GF Sbjct: 2 SHSNDQNQPQVWN-SAIAYESKDIAPGPNYQVPPPAI---ITHEEKVPPNGETKFKGDGF 57 Query: 299 WR 304 WR Sbjct: 58 WR 59 >XP_007155193.1 hypothetical protein PHAVU_003G181200g [Phaseolus vulgaris] ESW27187.1 hypothetical protein PHAVU_003G181200g [Phaseolus vulgaris] Length = 70 Score = 66.6 bits (161), Expect = 5e-12 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 146 NQPQVWNNSGVADKSKDTVAGPYQVPSPAIAIAITHEAPPSGETKFKGSGFWR 304 NQPQVWN SGVAD+SKDT GPY+VP P I + + ETKFKG GFWR Sbjct: 6 NQPQVWN-SGVADESKDTAPGPYEVPPPPPVITLEDKVE---ETKFKGDGFWR 54 >XP_004508639.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Cicer arietinum] Length = 76 Score = 65.5 bits (158), Expect = 2e-11 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +2 Query: 137 SDHNQPQVWNNSGVA---DKSKDTVAGPYQVPSPAIAIAITHEAPPS-GETKFKGSGFWR 304 +D NQPQVW NS +A D SKD+ AGPY +P P +ITH+ PPS +TK KGSGFWR Sbjct: 4 NDQNQPQVW-NSAIAYDDDVSKDSAAGPYPIPPP--PASITHKVPPSCTQTKLKGSGFWR 60 >KHN18396.1 hypothetical protein glysoja_006809 [Glycine soja] Length = 96 Score = 63.2 bits (152), Expect = 2e-10 Identities = 37/73 (50%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = +2 Query: 95 RCHSKTININSSNMSDHNQPQVWNNSGVADKSKDTVAGP-YQVPSPAIAIAITHE--APP 265 R H + S+ +D NQPQ + +SKD GP YQVP PAI ITHE PP Sbjct: 18 RKHLAFFKLKMSHSNDQNQPQAY-------ESKDIAPGPNYQVPPPAI---ITHEEKVPP 67 Query: 266 SGETKFKGSGFWR 304 +GETKFKG GFWR Sbjct: 68 NGETKFKGDGFWR 80 >XP_003524498.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Glycine max] KHN15183.1 hypothetical protein glysoja_011801 [Glycine soja] KRH56745.1 hypothetical protein GLYMA_05G017100 [Glycine max] Length = 78 Score = 61.6 bits (148), Expect = 5e-10 Identities = 37/63 (58%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = +2 Query: 128 SNMSDHN-QPQVWNNSGVADKSKDTVAGP-YQVPSPAIAIAITHE--APPSGETKFKGSG 295 S+ +D N QPQ WN+S +A + KD GP YQ P P AI ITHE PP+GETKFKG G Sbjct: 2 SHSNDQNCQPQGWNSS-LAYEPKDIAPGPNYQAPPPPPAI-ITHEEKVPPNGETKFKGDG 59 Query: 296 FWR 304 FWR Sbjct: 60 FWR 62 >XP_013458040.1 hypothetical protein MTR_4g112890 [Medicago truncatula] KEH32071.1 hypothetical protein MTR_4g112890 [Medicago truncatula] Length = 54 Score = 56.6 bits (135), Expect = 3e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +2 Query: 143 HNQPQVWNNSGVADKSKDTVAGPYQVPSPA-IAIAITHEAPPSGETKFKGSGFWR 304 HNQPQ ++ D+SKDT GPY P PA + + P + ETKFKGSGFWR Sbjct: 3 HNQPQAYD-----DQSKDTAVGPYLAPPPATVHKGYSQNVPQNRETKFKGSGFWR 52 >XP_003609184.1 hypothetical protein MTR_4g112890 [Medicago truncatula] AES91381.1 hypothetical protein MTR_4g112890 [Medicago truncatula] AFK34007.1 unknown [Medicago truncatula] Length = 68 Score = 56.6 bits (135), Expect = 4e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +2 Query: 143 HNQPQVWNNSGVADKSKDTVAGPYQVPSPA-IAIAITHEAPPSGETKFKGSGFWR 304 HNQPQ ++ D+SKDT GPY P PA + + P + ETKFKGSGFWR Sbjct: 3 HNQPQAYD-----DQSKDTAVGPYLAPPPATVHKGYSQNVPQNRETKFKGSGFWR 52