BLASTX nr result
ID: Glycyrrhiza34_contig00008674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008674 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20022.1 hypothetical protein TSUD_273570 [Trifolium subterran... 54 4e-07 XP_002269112.1 PREDICTED: mitochondrial inner membrane protease ... 52 6e-06 >GAU20022.1 hypothetical protein TSUD_273570 [Trifolium subterraneum] Length = 148 Score = 54.3 bits (129), Expect = 4e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 118 MEEEDNTSFANGNGGTTVKECERMIQKSLKTPMVRFLRE 2 M + D S A+G GG ++KECERMIQKSLKTPMVRFLRE Sbjct: 1 MTDFDTPSSADG-GGQSLKECERMIQKSLKTPMVRFLRE 38 >XP_002269112.1 PREDICTED: mitochondrial inner membrane protease ATP23 homolog isoform X2 [Vitis vinifera] CBI17714.3 unnamed protein product, partial [Vitis vinifera] Length = 195 Score = 52.0 bits (123), Expect = 6e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 82 NGGTTVKECERMIQKSLKTPMVRFLRE 2 NGG TVKECE+MIQKSL+TPMV+FLRE Sbjct: 19 NGGMTVKECEQMIQKSLRTPMVKFLRE 45