BLASTX nr result
ID: Glycyrrhiza34_contig00008389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008389 (855 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019464933.1 PREDICTED: translation initiation factor IF-1, ch... 155 4e-44 GAU21302.1 hypothetical protein TSUD_371960 [Trifolium subterran... 148 3e-41 XP_003628540.1 translation initiation factor IF-1 [Medicago trun... 147 6e-41 XP_004517199.1 PREDICTED: translation initiation factor IF-1, ch... 145 5e-40 XP_016162869.1 PREDICTED: translation initiation factor IF-1, ch... 145 5e-40 XP_015972228.1 PREDICTED: translation initiation factor IF-1, ch... 145 6e-40 XP_007155215.1 hypothetical protein PHAVU_003G183400g [Phaseolus... 142 6e-39 XP_014507452.1 PREDICTED: translation initiation factor IF-1, ch... 141 1e-38 XP_017426887.1 PREDICTED: translation initiation factor IF-1, ch... 141 1e-38 KHN18372.1 Translation initiation factor IF-1, chloroplastic [Gl... 140 2e-38 NP_001237201.1 translation initiation factor IF-1, chloroplastic... 140 2e-38 XP_012066685.1 PREDICTED: translation initiation factor IF-1, ch... 140 6e-38 YP_009108794.1 translation initiation factor 1 [Oncinotis tenuil... 137 8e-38 ANY60487.1 translation initiation factor 1 (chloroplast) [Maesa ... 137 1e-37 YP_001294219.1 translational initiation factor 1 [Buxus microphy... 137 1e-37 AIW05892.1 translation initiation factor 1 (plastid) [Rhabdadeni... 137 1e-37 YP_004465222.1 translational initiation factor 1 [Jacobaea vulga... 137 1e-37 AGW05008.1 translation initiation factor 1 (plastid) [Vincetoxic... 137 1e-37 AGW04777.1 translation initiation factor 1 (plastid) [Orthosia s... 137 1e-37 YP_009235574.1 InfA (chloroplast) [Cynanchum wilfordii] AMD38415... 137 1e-37 >XP_019464933.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Lupinus angustifolius] OIV99157.1 hypothetical protein TanjilG_01132 [Lupinus angustifolius] Length = 148 Score = 155 bits (393), Expect = 4e-44 Identities = 91/153 (59%), Positives = 95/153 (62%), Gaps = 2/153 (1%) Frame = +3 Query: 156 MFTSSSLPFHTTPSVVXXXXXXXXXXXXXXXXXXXXCFPHPHNNNTLSFLLHRXXXXXXX 335 MFTSSS PFHT + F H H TLSFL Sbjct: 1 MFTSSSFPFHTP---ILNNPHPHHHNHLLLPLSSTLTFHHSH---TLSFLHPLPTPPATT 54 Query: 336 XXXXXXXXXXXXXGEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILP 515 EQKWVHEGLITESLPNGMFRVRLDN+DLILGY+SGKIRKNFVRILP Sbjct: 55 LILRAKPPTTDKSSEQKWVHEGLITESLPNGMFRVRLDNQDLILGYVSGKIRKNFVRILP 114 Query: 516 GDRVKVEVSRYDSSKGRIVYRLRNTS--GSGST 608 GDRVKVEVSRYDSSKGRIVYR+RNTS G GST Sbjct: 115 GDRVKVEVSRYDSSKGRIVYRIRNTSSGGGGST 147 >GAU21302.1 hypothetical protein TSUD_371960 [Trifolium subterraneum] Length = 148 Score = 148 bits (374), Expect = 3e-41 Identities = 89/159 (55%), Positives = 96/159 (60%), Gaps = 8/159 (5%) Frame = +3 Query: 156 MFTSSSLPFHTTPSVVXXXXXXXXXXXXXXXXXXXXCFPHPHNNN------TLSFLLHRX 317 MFTSSS+PFH P++ PHNNN T SFL Sbjct: 1 MFTSSSIPFHA-PTIHHSLSSTTTRSLSFL----------PHNNNLTLHLRTPSFLRPPP 49 Query: 318 XXXXXXXXXXXXXXXXXXX--GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIR 491 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIR Sbjct: 50 LNPSLPSIFTVSAKSSTPDKASEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIR 109 Query: 492 KNFVRILPGDRVKVEVSRYDSSKGRIVYRLRNTSGSGST 608 KNFVRILPGDRV+VEVSRYDSSKGRI+YR+RNT G S+ Sbjct: 110 KNFVRILPGDRVRVEVSRYDSSKGRIIYRIRNTPGGNSS 148 >XP_003628540.1 translation initiation factor IF-1 [Medicago truncatula] AET03016.1 translation initiation factor IF-1 [Medicago truncatula] Length = 147 Score = 147 bits (372), Expect = 6e-41 Identities = 71/77 (92%), Positives = 75/77 (97%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISG+IRKN+VRILPGDRV+VEVSRYDSS Sbjct: 71 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGRIRKNYVRILPGDRVRVEVSRYDSS 130 Query: 558 KGRIVYRLRNTSGSGST 608 KGRIVYRLRNT G GS+ Sbjct: 131 KGRIVYRLRNTPGGGSS 147 >XP_004517199.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Cicer arietinum] Length = 149 Score = 145 bits (366), Expect = 5e-40 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISG+IRKN+VRILPGDRV+VEVSRYDSS Sbjct: 73 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGRIRKNYVRILPGDRVRVEVSRYDSS 132 Query: 558 KGRIVYRLRNTSGSGST 608 KGRIVYRLRNT G S+ Sbjct: 133 KGRIVYRLRNTPGGNSS 149 >XP_016162869.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Arachis ipaensis] Length = 152 Score = 145 bits (366), Expect = 5e-40 Identities = 70/75 (93%), Positives = 74/75 (98%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLITESLPNGMFRVRLDN+DLILGY+SGKIRKNFVRILPGDRVKVEVSRYDS Sbjct: 78 GEQKWVHEGLITESLPNGMFRVRLDNQDLILGYVSGKIRKNFVRILPGDRVKVEVSRYDS 137 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR++S S Sbjct: 138 SKGRIVYRLRSSSSS 152 >XP_015972228.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Arachis duranensis] Length = 154 Score = 145 bits (366), Expect = 6e-40 Identities = 70/75 (93%), Positives = 74/75 (98%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLITESLPNGMFRVRLDN+DLILGY+SGKIRKNFVRILPGDRVKVEVSRYDS Sbjct: 80 GEQKWVHEGLITESLPNGMFRVRLDNQDLILGYVSGKIRKNFVRILPGDRVKVEVSRYDS 139 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR++S S Sbjct: 140 SKGRIVYRLRSSSSS 154 >XP_007155215.1 hypothetical protein PHAVU_003G183400g [Phaseolus vulgaris] ESW27209.1 hypothetical protein PHAVU_003G183400g [Phaseolus vulgaris] Length = 139 Score = 142 bits (358), Expect = 6e-39 Identities = 69/75 (92%), Positives = 73/75 (97%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLI ESLPNGMFRVRLDNEDLILGYISGKIRKN+VRILPGDRVKVEVSRYDS Sbjct: 65 GEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVSRYDS 124 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR+++ S Sbjct: 125 SKGRIVYRLRSSTSS 139 >XP_014507452.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Vigna radiata var. radiata] Length = 139 Score = 141 bits (356), Expect = 1e-38 Identities = 69/75 (92%), Positives = 73/75 (97%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLI ESLPNGMFRVRLDNEDLILGYISGKIRKN+VRILPGDRVKVEVSRYDS Sbjct: 65 GEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVSRYDS 124 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR+++ S Sbjct: 125 SKGRIVYRLRSSTPS 139 >XP_017426887.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Vigna angularis] KOM33166.1 hypothetical protein LR48_Vigan01g272200 [Vigna angularis] BAT76507.1 hypothetical protein VIGAN_01452400 [Vigna angularis var. angularis] Length = 139 Score = 141 bits (356), Expect = 1e-38 Identities = 69/75 (92%), Positives = 73/75 (97%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLI ESLPNGMFRVRLDNEDLILGYISGKIRKN+VRILPGDRVKVEVSRYDS Sbjct: 65 GEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVSRYDS 124 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR+++ S Sbjct: 125 SKGRIVYRLRSSTPS 139 >KHN18372.1 Translation initiation factor IF-1, chloroplastic [Glycine soja] Length = 126 Score = 140 bits (353), Expect = 2e-38 Identities = 68/75 (90%), Positives = 73/75 (97%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKWVHEGLI ESLPNGMFRVRLDNEDLILGYISGKIRKN+VRILPGDRVKVEV+RYDS Sbjct: 52 GEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVTRYDS 111 Query: 555 SKGRIVYRLRNTSGS 599 SKGRIVYRLR+++ S Sbjct: 112 SKGRIVYRLRSSTPS 126 >NP_001237201.1 translation initiation factor IF-1, chloroplastic [Glycine max] Q94KR7.1 RecName: Full=Translation initiation factor IF-1, chloroplastic; Flags: Precursor AAK38870.1 translation initiation factor IF1 [Glycine max] KRH03161.1 hypothetical protein GLYMA_17G080200 [Glycine max] Length = 138 Score = 140 bits (354), Expect = 2e-38 Identities = 74/108 (68%), Positives = 80/108 (74%) Frame = +3 Query: 276 PHNNNTLSFLLHRXXXXXXXXXXXXXXXXXXXXGEQKWVHEGLITESLPNGMFRVRLDNE 455 P + TLSFL GEQKWVHEGLI ESLPNGMFRVRLDNE Sbjct: 31 PPFHRTLSFLAPPPLLPAAPALSAASAAKPDKSGEQKWVHEGLIMESLPNGMFRVRLDNE 90 Query: 456 DLILGYISGKIRKNFVRILPGDRVKVEVSRYDSSKGRIVYRLRNTSGS 599 DLILGYISGKIRKN+VRILPGDRVKVEV+RYDSSKGRIVYRLR+++ S Sbjct: 91 DLILGYISGKIRKNYVRILPGDRVKVEVTRYDSSKGRIVYRLRSSTPS 138 >XP_012066685.1 PREDICTED: translation initiation factor IF-1, chloroplastic [Jatropha curcas] KDP42454.1 hypothetical protein JCGZ_00251 [Jatropha curcas] Length = 147 Score = 140 bits (352), Expect = 6e-38 Identities = 66/75 (88%), Positives = 70/75 (93%) Frame = +3 Query: 375 GEQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDS 554 GEQKW HEG +TESLPNGMFRVRLDNEDLI+GYISGKIRKNFVRILPGDRVKVEVSRYDS Sbjct: 71 GEQKWTHEGSVTESLPNGMFRVRLDNEDLIIGYISGKIRKNFVRILPGDRVKVEVSRYDS 130 Query: 555 SKGRIVYRLRNTSGS 599 S+GRI+YRLRN S Sbjct: 131 SRGRIIYRLRNRDSS 145 >YP_009108794.1 translation initiation factor 1 [Oncinotis tenuiloba] YP_009108624.1 translation initiation factor 1 [Echites umbellatus] YP_009108878.1 translation initiation factor 1 [Pentalinon luteum] YP_009108709.1 translation initiation factor 1 [Nerium oleander] YP_009186066.1 translation initiation factor 1 (chloroplast) [Gynochthodes nanlingensis] ADD29840.1 translational initiation factor 1 protein (chloroplast) [Nerium oleander] AIW05214.1 translation initiation factor 1 (plastid) [Aganosma cymosa] AIW05299.1 translation initiation factor 1 (plastid) [Echites umbellatus] AIW05384.1 translation initiation factor 1 (plastid) [Epigynum auritum] AIW05553.1 translation initiation factor 1 (plastid) [Nerium oleander] AIW05638.1 translation initiation factor 1 (plastid) [Oncinotis tenuiloba] AIW05722.1 translation initiation factor 1 (plastid) [Pentalinon luteum] AIW05807.1 translation initiation factor 1 (plastid) [Periploca sepium] ALO71386.1 translation initiation factor 1 (chloroplast) [Gynochthodes nanlingensis] Length = 77 Score = 137 bits (345), Expect = 8e-38 Identities = 63/70 (90%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVKVEVSRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKVEVSRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72 >ANY60487.1 translation initiation factor 1 (chloroplast) [Maesa montana] Length = 77 Score = 137 bits (344), Expect = 1e-37 Identities = 62/70 (88%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVK+EVSRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72 >YP_001294219.1 translational initiation factor 1 [Buxus microphylla] YP_007890408.1 translational initiation factor 1 (chloroplast) [Ardisia polysticta] A6MM71.1 RecName: Full=Translation initiation factor IF-1, chloroplastic ABQ45283.1 translational initiation factor 1 (chloroplast) [Buxus microphylla] AGG36919.1 translational initiation factor 1 (chloroplast) [Ardisia polysticta] Length = 77 Score = 137 bits (344), Expect = 1e-37 Identities = 62/70 (88%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVK+EVSRYDSS Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSS 62 Query: 558 KGRIVYRLRN 587 +GRI+YRLRN Sbjct: 63 RGRIIYRLRN 72 >AIW05892.1 translation initiation factor 1 (plastid) [Rhabdadenia biflora] Length = 77 Score = 137 bits (344), Expect = 1e-37 Identities = 62/70 (88%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVKVE+SRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKVEISRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72 >YP_004465222.1 translational initiation factor 1 [Jacobaea vulgaris] YP_009320314.1 translational initiation factor 1 (chloroplast) [Pericallis hybrida] ADO15444.1 translational initiation factor 1 (chloroplast) [Jacobaea vulgaris] ALE65963.1 translational initiation factor 1 (chloroplast) [Pericallis hybrida] AMX21776.1 translational initiation factor 1 (mitochondrion) [Dendrosenecio brassiciformis] ANS58028.1 InfA (chloroplast) [Ligularia fischeri] Length = 77 Score = 137 bits (344), Expect = 1e-37 Identities = 62/70 (88%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVK+EVSRYDSS Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSS 62 Query: 558 KGRIVYRLRN 587 +GRI+YRLRN Sbjct: 63 RGRIIYRLRN 72 >AGW05008.1 translation initiation factor 1 (plastid) [Vincetoxicum rossicum] Length = 89 Score = 137 bits (345), Expect = 1e-37 Identities = 63/70 (90%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVKVEVSRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKVEVSRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72 >AGW04777.1 translation initiation factor 1 (plastid) [Orthosia scoparia] Length = 89 Score = 137 bits (345), Expect = 1e-37 Identities = 63/70 (90%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVKVEVSRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKVEVSRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72 >YP_009235574.1 InfA (chloroplast) [Cynanchum wilfordii] AMD38415.1 InfA (chloroplast) [Cynanchum wilfordii] Length = 95 Score = 137 bits (345), Expect = 1e-37 Identities = 63/70 (90%), Positives = 70/70 (100%) Frame = +3 Query: 378 EQKWVHEGLITESLPNGMFRVRLDNEDLILGYISGKIRKNFVRILPGDRVKVEVSRYDSS 557 EQKW+HEGLITESLPNGMFRVRLDNEDLILGY+SGKIR++F+RILPGDRVKVEVSRYDS+ Sbjct: 3 EQKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKVEVSRYDST 62 Query: 558 KGRIVYRLRN 587 KGRI+YRLRN Sbjct: 63 KGRIIYRLRN 72