BLASTX nr result
ID: Glycyrrhiza34_contig00008372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008372 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003610558.1 phloem filament protein PP1 [Medicago truncatula]... 71 3e-14 XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus... 70 8e-14 XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 67 1e-12 XP_016197537.1 PREDICTED: cysteine proteinase inhibitor 1 [Arach... 65 5e-12 XP_007147650.1 hypothetical protein PHAVU_006G142600g [Phaseolus... 65 5e-12 XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 65 7e-12 KHN32962.1 Cysteine proteinase inhibitor 1 [Glycine soja] 64 9e-12 XP_003546187.1 PREDICTED: cysteine proteinase inhibitor 1 [Glyci... 64 9e-12 AJD79055.1 CPI-4 [Morus alba var. atropurpurea] 64 1e-11 XP_015959005.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 64 2e-11 XP_010094696.1 Cysteine proteinase inhibitor 5 [Morus notabilis]... 63 4e-11 AFK36154.1 unknown [Lotus japonicus] 63 5e-11 XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 62 6e-11 XP_015941654.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 61 8e-11 XP_017434771.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 62 8e-11 BAT87537.1 hypothetical protein VIGAN_05091900 [Vigna angularis ... 62 8e-11 XP_012090836.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 62 1e-10 XP_012090835.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 62 1e-10 GAU29860.1 hypothetical protein TSUD_379500 [Trifolium subterran... 60 3e-10 OIV96068.1 hypothetical protein TanjilG_27172 [Lupinus angustifo... 60 4e-10 >XP_003610558.1 phloem filament protein PP1 [Medicago truncatula] AES92755.1 phloem filament protein PP1 [Medicago truncatula] Length = 117 Score = 70.9 bits (172), Expect = 3e-14 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 AGTNYRL L+A+ GS+S Y+A+VWEK+WQH+RNLTSF P+H Sbjct: 75 AGTNYRLTLSASDGSYSKNYEAVVWEKIWQHFRNLTSFVPVH 116 >XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] XP_007154020.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26013.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26014.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] Length = 115 Score = 69.7 bits (169), Expect = 8e-14 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 AG NYRL L A GS SN Y+AIVWEK+WQH+RNLTSF P+H Sbjct: 73 AGVNYRLTLAATDGSSSNNYEAIVWEKVWQHFRNLTSFTPVH 114 >XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [Vigna radiata var. radiata] Length = 115 Score = 66.6 bits (161), Expect = 1e-12 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AG NYRLIL A+ GS SN Y+AIVWEK WQH+RNL+SF P+ Sbjct: 73 AGVNYRLILAASDGSSSNNYEAIVWEKTWQHFRNLSSFTPV 113 >XP_016197537.1 PREDICTED: cysteine proteinase inhibitor 1 [Arachis ipaensis] Length = 116 Score = 65.1 bits (157), Expect = 5e-12 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 AGTNYRL L A GS + YQA+VWEK W+H++NLTSF PLH Sbjct: 75 AGTNYRLDLKATDGSKTQDYQAVVWEKPWEHFKNLTSFTPLH 116 >XP_007147650.1 hypothetical protein PHAVU_006G142600g [Phaseolus vulgaris] ESW19644.1 hypothetical protein PHAVU_006G142600g [Phaseolus vulgaris] Length = 116 Score = 65.1 bits (157), Expect = 5e-12 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AGTNYRL+L A GGS + Y+A+VWEK W H+RNLTSFK L Sbjct: 73 AGTNYRLVLKAKGGSATTQYEAVVWEKTWVHFRNLTSFKAL 113 >XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [Vigna angularis] KOM33690.1 hypothetical protein LR48_Vigan01g324600 [Vigna angularis] BAT77323.1 hypothetical protein VIGAN_01542400 [Vigna angularis var. angularis] Length = 115 Score = 64.7 bits (156), Expect = 7e-12 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AG NYRL L A GS SN Y+AIVWEK WQH+RNLTSF P+ Sbjct: 73 AGLNYRLTLAAADGSSSNNYEAIVWEKAWQHFRNLTSFTPV 113 >KHN32962.1 Cysteine proteinase inhibitor 1 [Glycine soja] Length = 112 Score = 64.3 bits (155), Expect = 9e-12 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 +GTNYRL+L A GS + Y+AIVWEK W H+ NLTSFKPLH Sbjct: 71 SGTNYRLVLKAKDGSATASYEAIVWEKPWLHFMNLTSFKPLH 112 >XP_003546187.1 PREDICTED: cysteine proteinase inhibitor 1 [Glycine max] KRH11536.1 hypothetical protein GLYMA_15G115300 [Glycine max] Length = 112 Score = 64.3 bits (155), Expect = 9e-12 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 +GTNYRL+L A GS + Y+AIVWEK W H+ NLTSFKPLH Sbjct: 71 SGTNYRLVLKAKDGSATASYEAIVWEKPWLHFMNLTSFKPLH 112 >AJD79055.1 CPI-4 [Morus alba var. atropurpurea] Length = 114 Score = 63.9 bits (154), Expect = 1e-11 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 86 AGTNYRL+L G+ + Y+A+VWEK WQH+RNLTSFKP Sbjct: 73 AGTNYRLVLAVKNGATAERYEAVVWEKPWQHFRNLTSFKP 112 >XP_015959005.1 PREDICTED: cysteine proteinase inhibitor 1-like [Arachis duranensis] Length = 116 Score = 63.5 bits (153), Expect = 2e-11 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 AGTNYRL+L A GS + YQA+VWEK W+H++NLTSF LH Sbjct: 75 AGTNYRLVLKATDGSKTQDYQAVVWEKPWEHFKNLTSFTLLH 116 >XP_010094696.1 Cysteine proteinase inhibitor 5 [Morus notabilis] EXB56668.1 Cysteine proteinase inhibitor 5 [Morus notabilis] Length = 114 Score = 62.8 bits (151), Expect = 4e-11 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 86 AGTNYRL++ G+ + Y+A+VWEK WQH+RNLTSFKP Sbjct: 73 AGTNYRLVVAVTNGAAAERYEAVVWEKPWQHFRNLTSFKP 112 >AFK36154.1 unknown [Lotus japonicus] Length = 122 Score = 62.8 bits (151), Expect = 5e-11 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 3/45 (6%) Frame = -1 Query: 205 AGTNYRLILTANGGSHS---NIYQAIVWEKLWQHYRNLTSFKPLH 80 AGTNYRL++ A GGS S + Y+A+V+E+ W+H+RNLTSFKP+H Sbjct: 78 AGTNYRLVIAAKGGSRSAAASNYEALVYERSWEHFRNLTSFKPVH 122 >XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [Cicer arietinum] Length = 114 Score = 62.4 bits (150), Expect = 6e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 +G NYRL+L+AN GS SN Y+A+VWEK+W +RNLTSF +H Sbjct: 72 SGANYRLVLSANDGSVSNHYEAVVWEKVWLRFRNLTSFVQVH 113 >XP_015941654.1 PREDICTED: cysteine proteinase inhibitor 1-like [Arachis duranensis] Length = 83 Score = 61.2 bits (147), Expect = 8e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 +GTNYRLIL+A+ G ++ Y+AIVWEK WQ++R+LTSF P H Sbjct: 41 SGTNYRLILSASSGFATSNYEAIVWEKPWQNFRSLTSFNPAH 82 >XP_017434771.1 PREDICTED: cysteine proteinase inhibitor 5-like [Vigna angularis] KOM53321.1 hypothetical protein LR48_Vigan09g198000 [Vigna angularis] Length = 113 Score = 62.0 bits (149), Expect = 8e-11 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AGTNYRL+L GGS + Y+A+VWEK W +++NLTSFKPL Sbjct: 71 AGTNYRLVLKTKGGSATTNYEAVVWEKPWLNFKNLTSFKPL 111 >BAT87537.1 hypothetical protein VIGAN_05091900 [Vigna angularis var. angularis] Length = 117 Score = 62.0 bits (149), Expect = 8e-11 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AGTNYRL+L GGS + Y+A+VWEK W +++NLTSFKPL Sbjct: 75 AGTNYRLVLKTKGGSATTNYEAVVWEKPWLNFKNLTSFKPL 115 >XP_012090836.1 PREDICTED: cysteine proteinase inhibitor 5-like [Jatropha curcas] KDP21895.1 hypothetical protein JCGZ_03033 [Jatropha curcas] Length = 111 Score = 61.6 bits (148), Expect = 1e-10 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AGTNYRL+L NGG+ S Y+A+VWEK W++++NLTSFKP+ Sbjct: 70 AGTNYRLVLEVNGGA-SKDYEAVVWEKTWENFKNLTSFKPV 109 >XP_012090835.1 PREDICTED: cysteine proteinase inhibitor 5-like [Jatropha curcas] KDP21894.1 hypothetical protein JCGZ_03032 [Jatropha curcas] Length = 111 Score = 61.6 bits (148), Expect = 1e-10 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 AGTNYRL+L NGG+ S Y+A+VWEK W++++NLTSFKP+ Sbjct: 70 AGTNYRLVLEVNGGA-SKDYEAVVWEKTWENFKNLTSFKPV 109 >GAU29860.1 hypothetical protein TSUD_379500 [Trifolium subterraneum] Length = 117 Score = 60.5 bits (145), Expect = 3e-10 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPL 83 +GTNYRL+L+A S + Y+A+VWEK W H+RNLTSFKPL Sbjct: 77 SGTNYRLVLSAKDKSVAKNYEALVWEKPWLHFRNLTSFKPL 117 >OIV96068.1 hypothetical protein TanjilG_27172 [Lupinus angustifolius] Length = 95 Score = 59.7 bits (143), Expect = 4e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 205 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKPLH 80 +GTNYRL+LTA+ GS Y+A+V EKLW HYRNLTSF+ H Sbjct: 54 SGTNYRLLLTASDGSAVKRYEAVVLEKLWLHYRNLTSFELAH 95