BLASTX nr result
ID: Glycyrrhiza34_contig00005874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005874 (688 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015962298.1 PREDICTED: phenolic glucoside malonyltransferase ... 60 3e-07 XP_003552578.1 PREDICTED: phenolic glucoside malonyltransferase ... 59 2e-06 GAU19870.1 hypothetical protein TSUD_170960 [Trifolium subterran... 52 8e-06 GAU19863.1 hypothetical protein TSUD_170890 [Trifolium subterran... 52 1e-05 >XP_015962298.1 PREDICTED: phenolic glucoside malonyltransferase 1-like [Arachis duranensis] Length = 222 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 ESKDGSGGVEVGLVLNKHVMGLFHRFFHAGLC 98 ESKDGSGG++VGLVLNKHVM LF+ FHAGLC Sbjct: 191 ESKDGSGGIQVGLVLNKHVMHLFNELFHAGLC 222 >XP_003552578.1 PREDICTED: phenolic glucoside malonyltransferase 1-like [Glycine max] KHN13547.1 Agmatine coumaroyltransferase [Glycine soja] KRH01302.1 hypothetical protein GLYMA_18G268100 [Glycine max] Length = 479 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +3 Query: 3 ESKDGSGGVEVGLVLNKHVMGLFHRFFHAGLCVD 104 ESKDG GGVEVGL LNKHVM LFH FHAGL D Sbjct: 446 ESKDGRGGVEVGLALNKHVMDLFHTIFHAGLSFD 479 >GAU19870.1 hypothetical protein TSUD_170960 [Trifolium subterraneum] Length = 72 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +3 Query: 3 ESKDGSGGVEVGLVLNKHVMGLFHRFFHAGLCVD 104 ESKDG GGVEVGLVLNKH M LF + F GLC + Sbjct: 39 ESKDGRGGVEVGLVLNKHAMDLFSKLFVEGLCAN 72 >GAU19863.1 hypothetical protein TSUD_170890 [Trifolium subterraneum] Length = 82 Score = 52.4 bits (124), Expect = 1e-05 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +3 Query: 3 ESKDGSGGVEVGLVLNKHVMGLFHRFFHAGLCVD 104 ESKD GGVEVGLVLNK+VM LFH F GLC D Sbjct: 49 ESKDLKGGVEVGLVLNKNVMDLFHTIFDEGLCFD 82