BLASTX nr result
ID: Glycyrrhiza34_contig00005835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005835 (770 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24845.1 hypothetical protein TSUD_157590 [Trifolium subterran... 77 1e-12 >GAU24845.1 hypothetical protein TSUD_157590 [Trifolium subterraneum] Length = 705 Score = 77.4 bits (189), Expect = 1e-12 Identities = 38/82 (46%), Positives = 50/82 (60%) Frame = -2 Query: 247 ITIEVREKTARSPSDAWAHFSRDGDRAICNYYKKTYAPNSVSHKASNLHKYSMSCIKNPY 68 +T + K R PS AW +F R D+A C + K YA NS SH SN++K+ C+KNP Sbjct: 27 VTEVTKRKPVRKPSKAWKYFDRIKDKAKCRFCGKQYAANSSSHGTSNMNKHLKVCLKNPN 86 Query: 67 RVTYKKQKTIHHRKKSKGNPNS 2 R K+QKTI K+S+ NPNS Sbjct: 87 REVDKRQKTIAIGKESEDNPNS 108