BLASTX nr result
ID: Glycyrrhiza34_contig00005678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005678 (789 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015969703.1 PREDICTED: histone H1-like [Arachis duranensis] 56 8e-06 >XP_015969703.1 PREDICTED: histone H1-like [Arachis duranensis] Length = 236 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 PSNFRKLLLYHLKKNVASGKLAKVKGSFKL 90 PSNFRKLLLYHLKK V+SGKL KVKGSFKL Sbjct: 32 PSNFRKLLLYHLKKLVSSGKLVKVKGSFKL 61