BLASTX nr result
ID: Glycyrrhiza34_contig00005612
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005612 (760 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK48113.1 unknown [Medicago truncatula] 69 4e-12 CBI39675.3 unnamed protein product, partial [Vitis vinifera] 68 4e-11 XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [... 64 7e-09 XP_003626135.2 low temperature and salt responsive family protei... 57 2e-07 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 56 3e-07 KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] 55 5e-07 KRG96664.1 hypothetical protein GLYMA_19G224800 [Glycine max] 55 2e-06 XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bre... 54 2e-06 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 54 2e-06 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 54 2e-06 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 54 2e-06 KMZ61773.1 Low temperature and salt responsive protein [Zostera ... 53 5e-06 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 53 5e-06 XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radia... 53 5e-06 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 53 5e-06 XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglan... 52 7e-06 XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus ... 52 7e-06 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 52 7e-06 XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium r... 52 1e-05 XP_011087564.1 PREDICTED: hydrophobic protein RCI2B [Sesamum ind... 52 1e-05 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 69.3 bits (168), Expect = 4e-12 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 243 CLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLIN 371 CLPQVWLP GVL LFG +PFW+ WN LCYLC++QVI L ++ Sbjct: 15 CLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVINLAFVD 57 >CBI39675.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 68.2 bits (165), Expect = 4e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 240 WCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 353 WCLPQVW+P GVLDLFGA F + SWN LC LCHHQVI Sbjct: 60 WCLPQVWMPGGVLDLFGADFFRLPSWNCLCCLCHHQVI 97 >XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 64.3 bits (155), Expect = 7e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 237 TWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 353 +W LPQVWLP G+LDLF A W++ W++LC+LCHHQV+ Sbjct: 138 SWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQVM 176 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLKFGCHVEFW+CLVLTLF Sbjct: 2 GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF 39 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLK+GCHVEFWICLVLTLF Sbjct: 4 GTATCIDILLAIILPPLGVFLKYGCHVEFWICLVLTLF 41 >KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] Length = 57 Score = 55.5 bits (132), Expect = 5e-07 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = +3 Query: 273 VLDLFGAHPFWVYSWNHLCYLCHHQVI 353 +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 14 ILDLFGAYPFWLHSWNYLCCLCYHQVI 40 >KRG96664.1 hypothetical protein GLYMA_19G224800 [Glycine max] Length = 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = +3 Query: 273 VLDLFGAHPFWVYSWNHLCYLCHHQVI 353 +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 64 ILDLFGAYPFWLHSWNYLCCLCYHQVI 90 >XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] XP_009366022.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTA C GVFLKFGCHVEFWICLVLT F Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFF 42 >KMZ61773.1 Low temperature and salt responsive protein [Zostera marina] Length = 54 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 2 GTTNCIDILVAIFLPPIGVFLKFGCHVEFWICLLLTLF 39 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTA C GVFLKFGC+VEFWICLVLTLF Sbjct: 5 GTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLTLF 42 >XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] XP_017413861.1 PREDICTED: hydrophobic protein RCI2B [Vigna angularis] KOM35416.1 hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLK+GC VEFWICLVLTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF 42 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLKFGC VEFWICL+LTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLF 42 >XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLKFGC VEFWICL+LT+F Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLTIF 42 >XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 5 GTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLTLF 42 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GT TC GVFLKFGC VEFWICLVLTLF Sbjct: 5 GTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLTLF 42 >XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] XP_016667936.1 PREDICTED: hydrophobic protein RCI2B [Gossypium hirsutum] KJB82717.1 hypothetical protein B456_013G210800 [Gossypium raimondii] KJB82718.1 hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 52.0 bits (123), Expect = 1e-05 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +1 Query: 193 TATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 TATC GVFLKFGC VEFWICLVLTLF Sbjct: 6 TATCVDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42 >XP_011087564.1 PREDICTED: hydrophobic protein RCI2B [Sesamum indicum] Length = 57 Score = 52.0 bits (123), Expect = 1e-05 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +1 Query: 190 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 303 GTATC GVFLKFGC VEFWICL+LT+F Sbjct: 4 GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIF 41