BLASTX nr result
ID: Glycyrrhiza34_contig00005476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005476 (916 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN00817.1 hypothetical protein glysoja_000485 [Glycine soja] 57 7e-07 >KHN00817.1 hypothetical protein glysoja_000485 [Glycine soja] Length = 105 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/52 (57%), Positives = 33/52 (63%) Frame = -2 Query: 618 MVRTGTIIGDGGPHQAVGGDMVQGRVVLLRVSLKGMDTVLEPGPVLDPGMDM 463 MV+TGT GDG P A G MV R VL R + M VL+PGP LDPGMDM Sbjct: 1 MVQTGTTAGDGAPDPAPGTGMVPVRAVLQRALPEDMAMVLDPGPGLDPGMDM 52