BLASTX nr result
ID: Glycyrrhiza34_contig00005262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00005262 (582 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN04016.1 GDSL esterase/lipase [Glycine soja] 70 2e-10 >KHN04016.1 GDSL esterase/lipase [Glycine soja] Length = 741 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 131 LNCMCHGSPSV*YALIHISQVKCLYLPWESASESQLQDIMPDV 3 L+CM + + YALIH+SQVKCLYLPWESASESQLQDIMPDV Sbjct: 554 LHCMSLCAKVLCYALIHVSQVKCLYLPWESASESQLQDIMPDV 596